DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jhedup and AT2G45610

DIOPT Version :9

Sequence 1:NP_611085.2 Gene:Jhedup / 36779 FlyBaseID:FBgn0034076 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_182085.1 Gene:AT2G45610 / 819169 AraportID:AT2G45610 Length:324 Species:Arabidopsis thaliana


Alignment Length:234 Identity:53/234 - (22%)
Similarity:93/234 - (39%) Gaps:77/234 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 FAQPPVGPLRLKNPVPNEPWEGVLDAGAAKDSCIQRSYFAKEWGLMGVEDCLYLNVYRPKN---- 111
            |..|.|.|    :|   :|..|.|  .|:||..|..            |..:.:.::||.|    
plant    29 FVWPRVEP----DP---DPCPGKL--AASKDVTINH------------ETGVSVRIFRPTNLPSN 72

  Fly   112 -RAEDKLPVMVYIHGGGFFSGSAHPMASGP--EYLMDTNKVVMVTMNYRLGPFGFLSTGDEH-MP 172
             .|..:||:::::||.|:....|:..|:..  ..:.....|::|:::|||.|        || :|
plant    73 DNAVARLPIIIHLHGSGWILYPANSAANDRCCSQMASELTVIVVSVHYRLPP--------EHRLP 129

  Fly   173 GNFGFKDQRL-ALQWIQKHIA-TFGGDP--------KKVTVLGHSAG-GISAHL------HMISP 220
            ..:   |..| ||.|:::.:. :..|:|        .:..:.|.|.| .|:..|      |.::|
plant   130 AQY---DDALDALLWVKQQVVDSTNGEPWLKDYADFSRCYICGSSNGANIAFQLALRSLDHDLTP 191

  Fly   221 NSKGLFQNSMSLTGTMFL-----------SAMKILKDPL 248
                     :.:.|.:|.           |.:|...||:
plant   192 ---------LQIDGCVFYQPLFGGKTRTKSELKNFADPV 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhedupNP_611085.2 COesterase 31..508 CDD:278561 53/234 (23%)
Aes <106..>210 CDD:223730 30/122 (25%)
AT2G45610NP_182085.1 Aes 57..323 CDD:223730 40/185 (22%)
Abhydrolase_3 82..303 CDD:285143 34/160 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X33
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.