DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jhedup and AT2G03550

DIOPT Version :9

Sequence 1:NP_611085.2 Gene:Jhedup / 36779 FlyBaseID:FBgn0034076 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_178453.1 Gene:AT2G03550 / 814884 AraportID:AT2G03550 Length:312 Species:Arabidopsis thaliana


Alignment Length:292 Identity:75/292 - (25%)
Similarity:117/292 - (40%) Gaps:72/292 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RGTLMPGYQSGEFEAFMGIPFAQPPVGPLRLKNPVPNEPWEGVLDAGAAKDSCIQRSYFAKEWGL 95
            |..:...|:||..|..:|.....|.:           .|..||:    :||.            :
plant     9 RSPMFRVYKSGRIERLLGETTVPPSL-----------TPQNGVV----SKDI------------I 46

  Fly    96 MGVEDCLYLNVYRPKNRAEDKLPVMVYIHGGGFFSGSAHPMASGPEYLMDTNKV-----VMVTMN 155
            ...|..|.|.:|.|:.....|||:::|.|||||...:|.   |.|.:...|:.|     :.:::|
plant    47 HSPEKNLSLRIYLPEKVTVKKLPILIYFHGGGFIIETAF---SPPYHTFLTSAVAAANCLAISVN 108

  Fly   156 YRLGPFGFLSTGDEHMPGNFGFKDQRLALQWIQKHIATFG--------GDPKKVTVLGHSAGG-I 211
            ||..|         ..|....::|...:|:|:..||...|        ||..||.:.|.|||| |
plant   109 YRRAP---------EFPVPIPYEDSWDSLKWVLTHITGTGPETWINKHGDFGKVFLAGDSAGGNI 164

  Fly   212 SAHLHMISPNSKGLFQNSMSLTGTMFLSAMKILKDPLS--QARRLGKELAID----QAESLSSQD 270
            |.||.|.:...|  ..:|: ::|.:.:......|.|:.  :.|.:||...::    .|...|.|.
plant   165 SHHLTMRAKKEK--LCDSL-ISGIILIHPYFWSKTPIDEFEVRDVGKTKGVEGSWRVASPNSKQG 226

  Fly   271 LAEALRNV---------CPKKL-LVSVDSLKV 292
            :.:...||         |.:.| :|:.|.|.|
plant   227 VDDPWLNVVGSDPSGLGCGRVLVMVAGDDLFV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhedupNP_611085.2 COesterase 31..508 CDD:278561 75/292 (26%)
Aes <106..>210 CDD:223730 34/116 (29%)
AT2G03550NP_178453.1 Aes <55..311 CDD:223730 61/219 (28%)
Abhydrolase_3 71..291 CDD:285143 55/203 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto2946
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X33
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.