DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jhedup and Bche

DIOPT Version :9

Sequence 1:NP_611085.2 Gene:Jhedup / 36779 FlyBaseID:FBgn0034076 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_075231.1 Gene:Bche / 65036 RGDID:619996 Length:597 Species:Rattus norvegicus


Alignment Length:449 Identity:152/449 - (33%)
Similarity:220/449 - (48%) Gaps:71/449 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GCMRGTLMPGYQSGEFEAFMGIPFAQPPVGPLRLKNPVPNEPWEGVLDAGAAKDSCIQRSYFAKE 92
            |.:||..|| ...|...||:|||:||||:|.||.|.|.|...|..|.:|....:||.|....|..
  Rat    34 GRVRGLSMP-ILGGTVTAFLGIPYAQPPLGSLRFKKPQPLNKWPDVYNATKYANSCYQNIDQAFP 97

  Fly    93 WGLMG----------VEDCLYLNVY----RPKNRAEDKLPVMVYIHGGGFFSG-SAHPMASGPEY 142
             |..|          .||||||||:    :|||..     |||:::||||.:| |:.|:..| ::
  Rat    98 -GFQGSEMWNPNTNLSEDCLYLNVWIPVPKPKNAT-----VMVWVYGGGFQTGTSSLPVYDG-KF 155

  Fly   143 LMDTNKVVMVTMNYRLGPFGFLS-TGDEHMPGNFGFKDQRLALQWIQKHIATFGGDPKKVTVLGH 206
            |....:|::|:||||:|..|||: .|:...|||.|..||:|||||||::||.|||:||.||:.|.
  Rat   156 LTRVERVIVVSMNYRVGALGFLAFPGNSEAPGNMGLFDQQLALQWIQRNIAAFGGNPKSVTLFGE 220

  Fly   207 SAGGISAHLHMISPNSKGLFQNSMSLTGTMFLSAMKILKDP-------LSQARRLG--KELAIDQ 262
            |||..|..||::.|.|..||..::..:|:.  :|...:|.|       |:.|:.:|  ||...:.
  Rat   221 SAGAASVSLHLLCPQSYPLFTRAILESGSS--NAPWAVKHPEEARNRTLTLAKFIGCSKENEKEI 283

  Fly   263 AESLSSQDLAEALRNVCPKKLLVSVDSLKVWDNMPHLTTLPVLEAPSPDA-FLVEDPLDAHRAGR 326
            ...|.|:|..|.|.|   :||::..||::           .:...|:.|. ||.:.|....:.|:
  Rat   284 ITCLRSKDPQEILLN---EKLVLPSDSIR-----------SINFGPTVDGDFLTDMPHTLLQLGK 334

  Fly   327 INQMPWILSLSSRAGEGSLFIMR-----AFINPKL--RAEFNENFLEHMALLLNLPEGTPVQMVS 384
            :.....::.::.  .||:.|::.     :..|..|  |.||.|....:...:.:|.:       .
  Rat   335 VKTAQILVGVNK--DEGTAFLVYGAPGFSKDNDSLITRREFQEGLNMYFPGVSSLGK-------E 390

  Fly   385 EILDAY-DFKGDSLNNDTMLKLAEISGDFNFYYPIYETISSYVTYANLEENPLFIYIFE 442
            .||..| |:.||...........:|.||:|...|..|....   :|.||.| .|.|.||
  Rat   391 AILFYYVDWLGDQTPEVYREAFDDIIGDYNIICPALEFTKK---FAELEIN-AFFYYFE 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhedupNP_611085.2 COesterase 31..508 CDD:278561 151/446 (34%)
Aes <106..>210 CDD:223730 52/109 (48%)
BcheNP_075231.1 COesterase 21..545 CDD:278561 152/449 (34%)
Aes <120..>272 CDD:223730 66/159 (42%)
AChE_tetra 560..594 CDD:285837
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.