DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jhedup and NLGN2

DIOPT Version :9

Sequence 1:NP_611085.2 Gene:Jhedup / 36779 FlyBaseID:FBgn0034076 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_065846.1 Gene:NLGN2 / 57555 HGNCID:14290 Length:835 Species:Homo sapiens


Alignment Length:603 Identity:161/603 - (26%)
Similarity:250/603 - (41%) Gaps:148/603 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GEFEAFMGIPFAQPPVGPLRLKNPVPNEPWEGVLDAGAAKDSCIQRSYFAKEWGLMGV------- 98
            |....|:|:|:|.||:|..|.:.|.....|.||.:|.....:|.|..:.|....::.|       
Human    64 GPVVQFLGVPYATPPLGARRFQPPEAPASWPGVRNATTLPPACPQNLHGALPAIMLPVWFTDNLE 128

  Fly    99 ----------EDCLYLNVYRP-------KNRAE-------------DKLPVMVYIHGGGFFSGSA 133
                      |||||||:|.|       |.|.|             .|.|||:::|||.:..|:.
Human   129 AAATYVQNQSEDCLYLNLYVPTEDGPLTKKRDEATLNPPDTDIRDPGKKPVMLFLHGGSYMEGTG 193

  Fly   134 HPMASGPEYLMDTNKVVMVTMNYRLGPFGFLSTGDEHMPGNFGFKDQRLALQWIQKHIATFGGDP 198
            : |..| ..|.....|::.|:|||||..|||||||:...||:|..||..||:|:.::||.|||||
Human   194 N-MFDG-SVLAAYGNVIVATLNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWLSENIAHFGGDP 256

  Fly   199 KKVTVLGHSAGGISAHLHMISPNSKGLFQNSMSLTGTMFLSAMKILKDPLSQARRLGKELAIDQA 263
            :::|:.|..||....:|.::|.:|:||||.:::.:||. :|:..:...||...|.|..::..|:.
Human   257 ERITIFGSGAGASCVNLLILSHHSEGLFQKAIAQSGTA-ISSWSVNYQPLKYTRLLAAKVGCDRE 320

  Fly   264 ESLSSQDLAEALRNVCPKKLLVSVDSLKVWDNMPHLTTLPVLEAP-SPDAFLVEDPLDAHRAGRI 327
            :   |.:..|.||.. |.:.||..|   |.....|:...||::.. .||     ||....:.|..
Human   321 D---SAEAVECLRRK-PSRELVDQD---VQPARYHIAFGPVVDGDVVPD-----DPEILMQQGEF 373

  Fly   328 NQMPWILSLSSRAGEGSLFI-----------MRAFINPKLRAEFN-ENFLEHMALLLNLPEGTPV 380
            .....::.::.  |||..|:           ..||       :|. .||:::   |...|||..|
Human   374 LNYDMLIGVNQ--GEGLKFVEDSAESEDGVSASAF-------DFTVSNFVDN---LYGYPEGKDV 426

  Fly   381 QMVSEIL-----DAYDFKGDSLNNDTMLKLAEISGDFNFYYPIYETISSYVTYANLEENPLFIYI 440
              :.|.:     |..|.....:...|:|.|..   |..:..|...|...:..|    ::|::.|.
Human   427 --LRETIKFMYTDWADRDNGEMRRKTLLALFT---DHQWVAPAVATAKLHADY----QSPVYFYT 482

  Fly   441 F----------EFAGLNSITKFFAGTTDDYGLGAVHMDDGLHTIRIPV--SFDDFPKD--SEDAK 491
            |          |:|                  .|.|.|:..:...:|:  :.|.||.:  ..|..
Human   483 FYHHCQAEGRPEWA------------------DAAHGDELPYVFGVPMVGATDLFPCNFSKNDVM 529

  Fly   492 VIQRMSSLMTDFAKTG-----------VFH------EESICKVSDFKEQGMCNYLHFGGNKEKYL 539
            :...:.:..|:|||||           ..|      ||.:....:.||:   .|||.|....   
Human   530 LSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVVWSKFNSKEK---QYLHIGLKPR--- 588

  Fly   540 EDIRNSITLTAFPIWKKL 557
              :|::........|.:|
Human   589 --VRDNYRANKVAFWLEL 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhedupNP_611085.2 COesterase 31..508 CDD:278561 149/546 (27%)
Aes <106..>210 CDD:223730 48/123 (39%)
NLGN2NP_065846.1 COesterase 41..601 CDD:278561 159/598 (27%)
Aes <170..>268 CDD:223730 43/99 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 623..668
Required for interaction with LHFPL4. /evidence=ECO:0000250|UniProtKB:Q69ZK9 678..698
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 790..835
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142735
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.