DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jhedup and si:dkey-193c22.1

DIOPT Version :9

Sequence 1:NP_611085.2 Gene:Jhedup / 36779 FlyBaseID:FBgn0034076 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001093504.1 Gene:si:dkey-193c22.1 / 567837 ZFINID:ZDB-GENE-030131-7957 Length:370 Species:Danio rerio


Alignment Length:364 Identity:71/364 - (19%)
Similarity:134/364 - (36%) Gaps:114/364 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 WGLMGVEDCLYLNVYRPKNRAEDK--LPVMVYIHGGGFFSGS-------AHPMASGPEYLMDTNK 148
            :|..|.:..||   |.|:....|:  :||:|:::||.:.||.       |..||.      :.|.
Zfish    95 FGRRGNKLDLY---YSPRLELSDESPVPVVVFVYGGAWGSGDRSIYCLLALQMAK------ELNA 150

  Fly   149 VVMVTMNYRLGPFGFLSTGDEHMPGNFGFKDQRLALQWIQKHIATFGGDPKKVTVLGHSAGGISA 213
            .| :..:|.:.|.|.:..         ..:|...:|.|:::....|..|...:.::|||||   |
Zfish   151 SV-ICPDYSIYPKGNVLN---------MVQDISDSLLWVRQKGHAFSLDQDNIILIGHSAG---A 202

  Fly   214 HL-----HMISPNSKGLF-----QNSM--SLTGTMFLSAMKILKDPLSQARRLGKELAIDQAESL 266
            ||     ..::.|.:.||     |..:  ::.|.:.||.:..:.|..:..    |..|::...::
Zfish   203 HLCALTSLFLASNVEELFIETNKQKDLVTAIKGIIGLSGVYSIMDHYNHE----KVRAVEYVSTM 263

  Fly   267 -SSQDLAEALRNVCPKKLLVSVDSLKVWDNMPHLTTLPVLEAPSPDAFLVEDPLDAHRAGRINQM 330
             .:.|..|......|..||..:..    |.:..:..:.:....:.....||..:      |.:::
Zfish   264 HKAMDGVENFDYYSPTSLLKKMKE----DQLKRVPPMALFHGTNDIIVPVESSV------RFSEL 318

  Fly   331 PWILSLSSRAGEGSLFIMRAFINPKLRAEFNENFLEHMALLLNLPEGTPVQMVSEILDAYDFKGD 395
              :.|||.|                            |:|.| :|:.....||::::        
Zfish   319 --LTSLSIR----------------------------MSLYL-IPKMNHTDMVTDLM-------- 344

  Fly   396 SLNNDTMLKLAEISGDFNFYYPIYETI----SSYVTYAN 430
                         :.|.:||:.:|..|    |.:.|:.:
Zfish   345 -------------APDRHFYHTVYGCIKHEYSKFQTHTD 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhedupNP_611085.2 COesterase 31..508 CDD:278561 71/364 (20%)
Aes <106..>210 CDD:223730 27/112 (24%)
si:dkey-193c22.1NP_001093504.1 Aes 87..336 CDD:223730 62/307 (20%)
Abhydrolase 121..>210 CDD:304388 26/107 (24%)
Abhydrolase 167..336 CDD:304388 40/225 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.