DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jhedup and alpha-Est2

DIOPT Version :9

Sequence 1:NP_611085.2 Gene:Jhedup / 36779 FlyBaseID:FBgn0034076 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001262345.1 Gene:alpha-Est2 / 40908 FlyBaseID:FBgn0015570 Length:566 Species:Drosophila melanogaster


Alignment Length:495 Identity:153/495 - (30%)
Similarity:238/495 - (48%) Gaps:43/495 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GCMRGTLMPGYQSGEFEAFMGIPFAQPPVGPLRLKNPVPNEPWEGVLDAGAAKDSCIQRSYFAKE 92
            |..|.|:   |....:.||.|||:|:||||.||.:.|.|.|||:|||:....:...:||:...  
  Fly    44 GLQRKTV---YDKEPYFAFEGIPYAKPPVGDLRFRAPQPPEPWQGVLNCTTNRSKPMQRNMLL-- 103

  Fly    93 WGLM-GVEDCLYLNVYRPKNRAEDKLPVMVYIHGGGFFSGSAHPMASGPEYLMDTNKVVMVTMNY 156
             |:: |.||||:||||....::|..|||:|:|:||||..|.|......|:|.| ...||.|.:||
  Fly   104 -GIVEGSEDCLHLNVYVKALKSEKPLPVIVWIYGGGFQKGEASRDIYSPDYFM-KKPVVFVAINY 166

  Fly   157 RLGPFGFLSTGDEHM--PGNFGFKDQRLALQWIQKHIATFGGDPKKVTVLGHSAGGISAHLHMIS 219
            ||...||||..|..:  |||.|.|||.:||:||.::||.|.|||..:|::|.|||..|.|:.|.:
  Fly   167 RLAALGFLSLKDPKLDVPGNAGLKDQVMALRWISQNIAHFNGDPNNITLMGESAGSASVHVMMTT 231

  Fly   220 PNSKGLFQNSMSLTGTMFLSAMKILKDPLSQ-ARRLGKELAIDQAESLSSQDLAEALRNVCPKKL 283
            ..::|||..::..:|   .:..:.::.|.:. |.||.:.|.....|  ...|:...|..||.:: 
  Fly   232 EQTRGLFHKAIMQSG---CALSEWVESPDNNWAFRLAQNLGYKGDE--KDADVLSFLSKVCARQ- 290

  Fly   284 LVSVDSLKVWDNMPHLTTL------PVLEAPSPDAFLV---EDPLDAHRAGRINQMPWILSLSSR 339
            :.::|...:  |:..:.:.      ||:|....|..:|   ...|.:...|  |.:|.|:..:|.
  Fly   291 IAAIDQDVI--NLDEVRSFLLFAFGPVIEPYETDHCVVPKRHKDLLSEAWG--NDIPVIVGGNSF 351

  Fly   340 AGEGSLFIMRAFINPKLRAEFNENFLEHMALLLNLPEGTPVQMVSEILDAYDFKGDSLNNDTMLK 404
            .|..|..::|.  :|.....|: |.|.......:..||..: :|..:...| |..:...:..|.:
  Fly   352 EGLFSYQLVRK--DPWALKNFH-NILPREVRETSSLEGQDL-LVRRLKQLY-FNNEMQESMEMFE 411

  Fly   405 LAEISGDFNFYYPIYETISSYVTYANLEENPLFIYIFEFAG--LNSITKFFAGTTDDYGLGAVHM 467
            ...|......::..:..|.:..:||  .:.|.::|.|:|..  .|...:...|   |...|..|.
  Fly   412 ALNIFSHRQIWHDTHRFILARQSYA--PKTPTYLYRFDFDSPHFNQFRRLVCG---DRIRGVAHA 471

  Fly   468 DDGLHTIRIPVSFDDFPKDSEDAKVIQRMSSLMTDFAKTG 507
            |: |..:...:......|.|.:.|.|:||..:.|.||.:|
  Fly   472 DE-LSYLFYNIIASKLDKSSMEYKTIERMVGMWTSFASSG 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhedupNP_611085.2 COesterase 31..508 CDD:278561 152/492 (31%)
Aes <106..>210 CDD:223730 50/105 (48%)
alpha-Est2NP_001262345.1 COesterase 32..523 CDD:278561 153/495 (31%)
Aes <117..>221 CDD:223730 49/104 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440393
Domainoid 1 1.000 98 1.000 Domainoid score I1867
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1664
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D206516at33208
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 1 1.000 - - otm46967
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X33
98.800

Return to query results.
Submit another query.