DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jhedup and Cel

DIOPT Version :9

Sequence 1:NP_611085.2 Gene:Jhedup / 36779 FlyBaseID:FBgn0034076 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_058693.2 Gene:Cel / 24254 RGDID:2331 Length:612 Species:Rattus norvegicus


Alignment Length:589 Identity:160/589 - (27%)
Similarity:257/589 - (43%) Gaps:104/589 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLFAGFGVLLFVAVAVGDSLDVCLEDMGCMRG-----TLMPGYQSGEFEAFMGIPFAQPPVGPLR 60
            :||.|....|  |.|....|.....:.|.:.|     :|:.|   ...:.|.|||||....    
  Rat     6 VLFLGLTCCL--AAACAAKLGAVYTEGGFVEGVNKKLSLLGG---DSVDIFKGIPFATAKT---- 61

  Fly    61 LKNPVPNEPWEGVLDAGAAKDSCIQRSYFAKEWGLMGVEDCLYLNVYRPKNRAE--DKLPVMVYI 123
            |:||..:..|:|.|.|...|..|:|.:....:  ..|.|||||||::.|:.|.:  ..|||||:|
  Rat    62 LENPQRHPGWQGTLKATDFKKRCLQATITQDD--TYGQEDCLYLNIWVPQGRKQVSHDLPVMVWI 124

  Fly   124 HGGGFFSGSAHPMASGPEYLMD------TNKVVMVTMNYRLGPFGFLSTGDEHMPGNFGFKDQRL 182
            :||.|..||.........||.|      ...|::||.|||:||.|||||||.::|||||.:||.:
  Rat   125 YGGAFLMGSGQGANFLKNYLYDGEEIATRGNVIVVTFNYRVGPLGFLSTGDANLPGNFGLRDQHM 189

  Fly   183 ALQWIQKHIATFGGDPKKVTVLGHSAGGISAHLHMISPNSKGLFQNSMSLTGTMFLSAMKILKDP 247
            |:.|::::||.|||||..:|:.|.|||..|..|..:||.:|||.:.::|.:| :.||...|.::|
  Rat   190 AIAWVKRNIAAFGGDPDNITIFGESAGAASVSLQTLSPYNKGLIRRAISQSG-VALSPWAIQENP 253

  Fly   248 LSQARRLGKELAIDQAESLSSQDLAEALRNVCPKKLLVSVDSLKVWDNMP----------HLTTL 302
            |..|:.:.|::.....::..   :|..|:...|:.|.::.       .:|          :|..:
  Rat   254 LFWAKTIAKKVGCPTEDTAK---MAGCLKITDPRALTLAY-------RLPLKSQEYPIVHYLAFI 308

  Fly   303 PVLEAPSPDAFLVEDPLDAH-RAGRINQMPWILSLSSRAGEGSLFIMRAFIN----PKLRAEFNE 362
            ||::..    |:.:||::.: .|..|:.:..|..:     :|.||   |.::    .|.:.:..|
  Rat   309 PVVDGD----FIPDDPINLYDNAADIDYLAGINDM-----DGHLF---ATVDVPAIDKAKQDVTE 361

  Fly   363 NFLEHMALLLNLPEGTPVQMVSEILDAY--DFKGDSLNNDTMLKLAEISGDFNFYYPIYETISSY 425
            .....:.....:.:|  ::......|.|  .:..|....:....:.....|..|..|....::.:
  Rat   362 EDFYRLVSGHTVAKG--LKGTQATFDIYTESWAQDPSQENMKKTVVAFETDILFLIPTEMALAQH 424

  Fly   426 VTYANLEENPLFIYIFEFAGLNSITKFFAGTTDDYGLGAVHMDDGLHTIRIPVSFDDFPKDSEDA 490
            ..:|...:.  :.|:|.......|...:        :||.|.||..:....|.: ......::|.
  Rat   425 RAHAKSAKT--YSYLFSHPSRMPIYPKW--------MGADHADDLQYVFGKPFA-TPLGYRAQDR 478

  Fly   491 KVIQRMSSLMTDFAKTGVFHEESICKVSDFKEQGMCN---------YLHFGGNKEKYLEDIRNSI 546
            .|.:.|.:..|:|||:|              :..|.|         |....||   || ||...|
  Rat   479 TVSKAMIAYWTNFAKSG--------------DPNMGNSPVPTHWYPYTTENGN---YL-DINKKI 525

  Fly   547 TLTA 550
            |.|:
  Rat   526 TSTS 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhedupNP_611085.2 COesterase 31..508 CDD:278561 139/506 (27%)
Aes <106..>210 CDD:223730 51/111 (46%)
CelNP_058693.2 COesterase 26..542 CDD:278561 153/567 (27%)
Aes <118..>247 CDD:223730 61/129 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 553..612
4 X 11 AA tandem repeats, O-glycosylated region 556..599
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336381
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.