DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jhedup and cest-13

DIOPT Version :9

Sequence 1:NP_611085.2 Gene:Jhedup / 36779 FlyBaseID:FBgn0034076 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_741921.1 Gene:cest-13 / 181493 WormBaseID:WBGene00010116 Length:548 Species:Caenorhabditis elegans


Alignment Length:462 Identity:131/462 - (28%)
Similarity:210/462 - (45%) Gaps:92/462 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLFVAVAVGDSLDVCLEDMGCMRGTLMPGYQSGEFEAFMGIPFAQPPVGPLRL-----KNPVPN 67
            :|.|.:|....:.||.::...  ....:.|.|.....:|.||.:||||||..|.     .:||  
 Worm    11 LLHFASVLADPTYDVTVQTPN--GSATIRGIQHTYGTSFRGIRYAQPPVGLFRFGAARRLDPV-- 71

  Fly    68 EPWEGVLDAGAAKDSCIQRSYFAKEWGLMGVEDCLYLNVYRPKNRAE-DKLPVMVYIHGGGFFSG 131
                |:::|.|..:.|:|..      |....||||::|||.|.|..: .||||.||||||||..|
 Worm    72 ----GLVEAQAYGNICVQGD------GRTSHEDCLFINVYTPNNVTQASKLPVYVYIHGGGFVEG 126

  Fly   132 SAHPMASGPEYLMDTNKVVMVTMNYRLGPFGFLSTGDEHMPGNFGFKDQRLALQWIQKHIATFGG 196
            ..:..|.....|::...:|||::|||||||||.||.....|||:...|...||.|:|::|:.|||
 Worm   127 GGNMGAGIYPNLVNKGPIVMVSINYRLGPFGFFSTRQMTAPGNWAISDWIEALNWVQRYISFFGG 191

  Fly   197 DPKKVTVLGHSAGGISAHLHMISPNSKGLFQNSMSLTGTMFLSAMKILKDPLSQARRLGKELAID 261
            ||.:||:.|.|:|..:.....::|.:|.||:.|:..:|:.|.:|:....:   :.|...|:|:|.
 Worm   192 DPNRVTIGGQSSGAEAVSTLTLTPLAKNLFKQSIHESGSAFGAAVMSYSE---KTRSTSKQLSIK 253

  Fly   262 QAESLSSQDLAEALRNVCPKKLLVSVDSLKVWDNMPHL-TTLPVLEAPSPDAFLVED-PLDAHRA 324
            ...:.|.|                       |||.... |.|..|...:.|..:..| .|..|| 
 Worm   254 LGCATSDQ-----------------------WDNGQSFGTILTCLRNVTYDKIVAADNSLPGHR- 294

  Fly   325 GRINQMPWILSLSSRAGEGSLFIMRAFINPKLRAEFNENFLEHMALLLNLPEGTPVQMVSEILDA 389
                 |.|.:...::           ::..:         ||::||..:..:..   ::.::.| 
 Worm   295 -----MKWSIVQDNK-----------YLTQR---------LEYLALQRDPKKNV---LIGDVHD- 330

  Fly   390 YDFKGDSLNNDTMLKLAEISGDFNFYYPIYETIS-SY-VTYANLEENPLFIYIFEFAGLNSITKF 452
             ::.|..:||    .|..|:...|..:.:.:.:| || :||.:.:::.|.....::  :|:    
 Worm   331 -EWLGWEMNN----VLHNINSSHNTAHQMRDDLSGSYEMTYWDNKQSVLVAADNKY--INN---- 384

  Fly   453 FAGTTDD 459
             .|.|||
 Worm   385 -QGWTDD 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhedupNP_611085.2 COesterase 31..508 CDD:278561 126/439 (29%)
Aes <106..>210 CDD:223730 51/104 (49%)
cest-13NP_741921.1 Abhydrolase 22..510 CDD:304388 128/451 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11559
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.