DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jhedup and AADAC

DIOPT Version :10

Sequence 1:NP_611085.2 Gene:Jhedup / 36779 FlyBaseID:FBgn0034076 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001077.2 Gene:AADAC / 13 HGNCID:17 Length:399 Species:Homo sapiens


Alignment Length:205 Identity:46/205 - (22%)
Similarity:81/205 - (39%) Gaps:49/205 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 YNDKFYL-----DVLESGELAKLA------YYNDVVVGAVCSRIDTSENMRRLYIMTLGCLYPYR 92
            |:||:.:     |:.::.|..|.|      .|..::..|:....:....:..:| .....::.|.
Human   469 YSDKYNVPISSADIAQNQEFYKNAEVRPPFTYASLIRQAILESPEKQLTLNEIY-NWFTRMFAYF 532

  Fly    93 RLGIGT--VMVQHILNCVERDGNFDSIFLH---VKVDN-KGA------IEFYKRFGFEI------ 139
            |....|  ..|:|.|:            ||   |:|:| |||      :||.||...:|      
Human   533 RRNAATWKNAVRHNLS------------LHKCFVRVENVKGAVWTVDEVEFQKRRPQKISGNPSL 585

  Fly   140 VETKQHYYKRIEPADAHVLQKTLTKKA-AVAAAAAMSCPHQHS-SDADREHQAGVA----NGDSH 198
            ::..|..:....|.:| .||.::.:.: .:...|:|..|...| :.|.||...|..    :.:|.
Human   586 IKNMQSSHAYCTPLNA-ALQASMAENSIPLYTTASMGNPTLGSLASAIREELNGAMEHTNSNESD 649

  Fly   199 EAAGEAPQPA 208
            .:.|.:|..|
Human   650 SSPGRSPMQA 659

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhedupNP_611085.2 alpha/beta hydrolases 31..508 CDD:473884 46/205 (22%)
AADACNP_001077.2 Abhydrolase_3 107..374 CDD:400284
Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole. /evidence=ECO:0000250|UniProtKB:Q5NUF3 111..113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.