DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asph and ASPHD2

DIOPT Version :9

Sequence 1:NP_001261020.1 Gene:Asph / 36778 FlyBaseID:FBgn0034075 Length:991 Species:Drosophila melanogaster
Sequence 2:NP_065170.2 Gene:ASPHD2 / 57168 HGNCID:30437 Length:369 Species:Homo sapiens


Alignment Length:340 Identity:88/340 - (25%)
Similarity:130/340 - (38%) Gaps:93/340 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   683 EDPRLRNQLSLTYLMVNNLQQVEKV-----------AVETLKLWPNNAVAQLHYGLALRQFH--A 734
            |.||       .|:.||:|.|....           :.|.::...|.       ||..:.:|  .
Human    81 EQPR-------PYVSVNSLMQAADANGLQNGYVYCQSPECVRCTHNE-------GLNQKLYHNLQ 131

  Fly   735 DYAKALPYLKYAVESG----EEGTQEAFFYLSLGETMQRLSMKSEALEVYGKGVAKGFFASLYQR 795
            :|||...:      ||    .:|.:|...||:...::|:..:               ||.     
Human   132 EYAKRYSW------SGMGRIHKGIREQGRYLNSRPSIQKPEV---------------FFL----- 170

  Fly   796 SLYNEPRLRAQPFWQPKETGYERQLEKLTLNWRAIRDEGLALLGRSGFFEDEAELLRD------- 853
                 |.|...|::  .....:..:|.|..|::.|..|          ||...:...:       
Human   171 -----PDLPTTPYF--SRDAQKHDVEVLERNFQTILCE----------FETLYKAFSNCSLPQGW 218

  Fly   854 ------KGVWQQYELYAQGRRVKDNCRRAPITCSLLEEFPESAGCR-RGQVKFSVMQAKTHVWPH 911
                  .|.|..:.|..||..|..|||:.|.|..||.......|.. .|....||:...|.:..|
Human   219 KMNSTPSGEWFTFYLVNQGVCVPRNCRKCPRTYRLLGSLRTCIGNNVFGNACISVLSPGTVITEH 283

  Fly   912 CGPTNCRLRAHLTLAAPEPEKASLRVAEQERTWREGELFIFDDSFEHEVWHNGSQS---RLVLIL 973
            .||||.|:|.||.|..  |....|.|..:.:.|.||...:|||||.|..:|.||..   |:|.::
Human   284 YGPTNIRIRCHLGLKT--PNGCELVVGGEPQCWAEGRCLLFDDSFLHAAFHEGSAEDGPRVVFMV 346

  Fly   974 DMWHPQLSAAQRRSL 988
            |:|||.::||:|::|
Human   347 DLWHPNVAAAERQAL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsphNP_001261020.1 TPR 610..854 CDD:223533 35/200 (18%)
TPR repeat 684..714 CDD:276809 8/40 (20%)
TPR repeat 719..748 CDD:276809 6/30 (20%)
TPR repeat 757..782 CDD:276809 3/24 (13%)
Asp_Arg_Hydrox 826..977 CDD:282913 51/167 (31%)
ASPHD2NP_065170.2 Asp_Arg_Hydrox 192..351 CDD:398678 52/170 (31%)
2-oxoglutarate binding. /evidence=ECO:0000250 292..294 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156782
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3555
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.700

Return to query results.
Submit another query.