DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asph and asphd2

DIOPT Version :9

Sequence 1:NP_001261020.1 Gene:Asph / 36778 FlyBaseID:FBgn0034075 Length:991 Species:Drosophila melanogaster
Sequence 2:NP_001073514.1 Gene:asphd2 / 569819 ZFINID:ZDB-GENE-061103-142 Length:371 Species:Danio rerio


Alignment Length:306 Identity:83/306 - (27%)
Similarity:115/306 - (37%) Gaps:98/306 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   726 GLALRQFHA--DYAKALPYLKYA-VESG--EEG-----------TQEAFFYLSLGET--MQRLSM 772
            ||..|.:|:  :|||...:.... |..|  |:|           ..|.||...|...  ..|.:.
Zfish   119 GLNQRLYHSLQEYAKRYTWAGMGRVHKGVREQGRYLLCSRPSIQKPEVFFLPDLPSAPFFSREAQ 183

  Fly   773 KS--EALEVYGKGVAKGFFASLYQ-RSLYNEPRLRA----QPFWQPKETGYERQLEKLTLNWRAI 830
            |.  |.||       :.|.|.|.: .|:|..|..|.    .|.|:...|                
Zfish   184 KHDVELLE-------RSFPALLAEFESVYRLPSSRTGSSLPPGWKANST---------------- 225

  Fly   831 RDEGLALLGRSGFFEDEAELLRDKGVWQQYELYAQGRRVKDNCRRAPITCSLLEEFPESAGCRRG 895
                                  .:|.|..:.|..||..:..|.||.|.|..:|           |
Zfish   226 ----------------------PRGQWWTFYLVNQGTPMVLNARRCPRTWRVL-----------G 257

  Fly   896 QVK------------FSVMQAKTHVWPHCGPTNCRLRAHLTLAAPEPEKASLRVAEQERTWREGE 948
            |::            |||:...:.:..|.||||.|||.||.|..  |....|.|..:.:.|.||.
Zfish   258 QLRTFIANNVFGNACFSVLSPGSTITEHYGPTNVRLRCHLGLKV--PSGCELVVGGEPQCWSEGS 320

  Fly   949 LFIFDDSFEHEVWHNGSQS---RLVLILDMWHPQLSAAQRRSLSPI 991
            ..:|||||.|..:|:||..   |.|.::|:|||.::||:|::|..|
Zfish   321 CLLFDDSFLHTAFHDGSAEDGPRAVFMVDLWHPNVAAAERQALDYI 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsphNP_001261020.1 TPR 610..854 CDD:223533 30/152 (20%)
TPR repeat 684..714 CDD:276809
TPR repeat 719..748 CDD:276809 7/24 (29%)
TPR repeat 757..782 CDD:276809 8/28 (29%)
Asp_Arg_Hydrox 826..977 CDD:282913 45/165 (27%)
asphd2NP_001073514.1 Asp_Arg_Hydrox 191..352 CDD:282913 56/218 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592421
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3555
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.700

Return to query results.
Submit another query.