DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asph and asphd1

DIOPT Version :9

Sequence 1:NP_001261020.1 Gene:Asph / 36778 FlyBaseID:FBgn0034075 Length:991 Species:Drosophila melanogaster
Sequence 2:XP_021330567.1 Gene:asphd1 / 557921 ZFINID:ZDB-GENE-091204-62 Length:354 Species:Danio rerio


Alignment Length:295 Identity:80/295 - (27%)
Similarity:118/295 - (40%) Gaps:79/295 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   746 AVESGEEGTQEAF-------------------FYLSLGETMQRLSMKSEALEVYGKG-VAKGF-- 788
            |||. ||||:...                   .|.:|.|..:|.|..       |.| :.||.  
Zfish    85 AVEE-EEGTESYLTPVLSHSPFPTDAAAGSRKLYRALQEYAKRYSWA-------GMGRIHKGLRN 141

  Fly   789 ------FASLYQRSLYNEPRLRAQPFWQPKETGYERQLEKLTLNWRAIRDEGLALLGRSGFFEDE 847
                  ..|:.:..|:..|.:.:.||: |:: .:...:|.|..::..|    ||          |
Zfish   142 QARINDRLSIQKPHLFYLPDVPSIPFF-PRD-AHRHDIEVLEASYPII----LA----------E 190

  Fly   848 AELLRDKGV-----WQQ--------YELYAQGRRVKDNCRRAPITCSL-----LEEFPESAGCRR 894
            .:.:..||:     |..        :.||..|..|..|||..|  ||.     |..|..|...  
Zfish   191 FQAVYQKGIDTKLGWSYQGPKGQTVFPLYNAGVCVASNCRACP--CSYRTLLSLRTFISSNSL-- 251

  Fly   895 GQVKFSVMQAKTHVWPHCGPTNCRLRAHLTLAAPEPEKASLRVAEQERTWREGELFIFDDSFEHE 959
            |...|.::.....:....||||.|||.||.|..  |.:..|.|..:.:.|.||...:.||||.|.
Zfish   252 GSAGFWLLGPGATLAGTYGPTNTRLRCHLGLQT--PAQCELVVGGEPQCWSEGHCLLVDDSFLHT 314

  Fly   960 VWHNGSQS---RLVLILDMWHPQLSAAQRRSLSPI 991
            :.|||:..   |::..:|:|||.::||:|::|..|
Zfish   315 ISHNGAAEDGPRVIFSVDLWHPNVAAAERQALDYI 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsphNP_001261020.1 TPR 610..854 CDD:223533 28/135 (21%)
TPR repeat 684..714 CDD:276809
TPR repeat 719..748 CDD:276809 1/1 (100%)
TPR repeat 757..782 CDD:276809 5/43 (12%)
Asp_Arg_Hydrox 826..977 CDD:282913 48/171 (28%)
asphd1XP_021330567.1 Asp_Arg_Hydrox 181..335 CDD:310005 48/173 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592423
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3555
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.