DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asph and IBSP

DIOPT Version :9

Sequence 1:NP_001261020.1 Gene:Asph / 36778 FlyBaseID:FBgn0034075 Length:991 Species:Drosophila melanogaster
Sequence 2:NP_004958.2 Gene:IBSP / 3381 HGNCID:5341 Length:317 Species:Homo sapiens


Alignment Length:310 Identity:75/310 - (24%)
Similarity:116/310 - (37%) Gaps:95/310 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 LEEEEEPTEEDEPAADEEYEEDEDEENNAGENITAEDAEEEEEEEDNDDEGTVEATVEATT---- 203
            ::...:.:||:...:.|| ||:|:|.:|.|||     .||..|:||::.|.|   |:.|||    
Human    60 VQGSSDSSEENGDDSSEE-EEEEEETSNEGEN-----NEESNEDEDSEAENT---TLSATTLGYG 115

  Fly   204 EATTEATGEYEAEEDDEDEAAADDDAVESTEAPLSKAEEQEDDEDEDEEEQEIEES-VEPERSQY 267
            |..|..|| |......:....|.|...::|     |.:|.:::|:|:||..|.||| .|.:.:: 
Human   116 EDATPGTG-YTGLAAIQLPKKAGDITNKAT-----KEKESDEEEEEEEEGNENEESEAEVDENE- 173

  Fly   268 AAQSAPAKDNNDDDDDDDQDKNDADDGDDDEFESLAQQFENDPEDTVPAKAVESEEQDQDQADEE 332
              |.......|..:.::....:..|:|:                        |.||:....|:.|
Human   174 --QGINGTSTNSTEAENGNGSSGGDNGE------------------------EGEEESVTGANAE 212

  Fly   333 EPKEEGSSWLASLAVKFGVGVALALVSRLVLIRKSPNTTEDEPAPETIFRRRLTIATAEDHIPDD 397
            :..|.|         :.|.|.:....        |||...:...|..::|     .|:       
Human   213 DTTETG---------RQGKGTSKTTT--------SPNGGFEPTTPPQVYR-----TTS------- 248

  Fly   398 VEELPPLDDEYSEEEIEIEEEIE----------VEISDIEEEEEEVRHDN 437
                ||..   ....:|.|.|.|          .||  .|.|..|.|.||
Human   249 ----PPFG---KTTTVEYEGEYEYTGANEYDNGYEI--YESENGEPRGDN 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsphNP_001261020.1 TPR 610..854 CDD:223533
TPR repeat 684..714 CDD:276809
TPR repeat 719..748 CDD:276809
TPR repeat 757..782 CDD:276809
Asp_Arg_Hydrox 826..977 CDD:282913
IBSPNP_004958.2 BSP_II 17..314 CDD:283165 75/310 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..254 63/271 (23%)
cell-attachment tripeptide 286..288 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.