DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asph and Asphd1

DIOPT Version :9

Sequence 1:NP_001261020.1 Gene:Asph / 36778 FlyBaseID:FBgn0034075 Length:991 Species:Drosophila melanogaster
Sequence 2:XP_215083.2 Gene:Asphd1 / 293498 RGDID:1306636 Length:360 Species:Rattus norvegicus


Alignment Length:279 Identity:81/279 - (29%)
Similarity:110/279 - (39%) Gaps:61/279 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   748 ESGEEGTQEAFFYLSLGETMQRLSMKSEALEVY------------------GKGVAKGF-FASLY 793
            ::|..|:.:.      ||..:...:.|..|..|                  |.|:..|. ...:.
  Rat    97 QTGSRGSGDP------GEGHRAEGLVSRRLRAYARRYSWAGMGRVRRAAQGGPGLTGGTGILGIQ 155

  Fly   794 QRSLYNEPRLRAQPFWQPKETGYERQLEKLTLNWRAI-RDEGLALLGRSGFFEDEAELLRDKGVW 857
            :..|...|.|.:.|| .|:: .....:|.|..::.|| ||.|..    |..|.....|.|.   |
  Rat   156 RPGLLFLPDLPSSPF-VPRD-AQRHDVELLQSSFPAILRDFGAV----SWDFSGSTPLPRG---W 211

  Fly   858 Q--------QYELYAQGRRVKDNCRRAPITCSLLEEFPESAGCRR-------GQVKFSVMQAKTH 907
            .        |..||..||....||||.|.....|.      |.|.       |...|||:.....
  Rat   212 SPPLAPGCYQLLLYQAGRCQPSNCRRCPGAYRALR------GLRSFMSANTFGNAGFSVLLPGAR 270

  Fly   908 VWPHCGPTNCRLRAHLTLAAPEPEKASLRVAEQERTWREGELFIFDDSFEHEVWHNGSQS---RL 969
            :...|||||.|:|.||.|..  |....|.|..:.:.|.||...:.||||.|.|.||||..   |:
  Rat   271 LEGRCGPTNARVRCHLGLKI--PPGCELVVGGEPQCWAEGHCLLVDDSFLHTVAHNGSPEDGPRV 333

  Fly   970 VLILDMWHPQLSAAQRRSL 988
            |.|:|:|||.::.|:|::|
  Rat   334 VFIVDLWHPNVAGAERQAL 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsphNP_001261020.1 TPR 610..854 CDD:223533 27/125 (22%)
TPR repeat 684..714 CDD:276809
TPR repeat 719..748 CDD:276809 81/279 (29%)
TPR repeat 757..782 CDD:276809 5/42 (12%)
Asp_Arg_Hydrox 826..977 CDD:282913 57/169 (34%)
Asphd1XP_215083.2 Asp_Arg_Hydrox 184..341 CDD:282913 57/171 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350707
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3555
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.