Sequence 1: | NP_001261020.1 | Gene: | Asph / 36778 | FlyBaseID: | FBgn0034075 | Length: | 991 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_859069.2 | Gene: | ASPHD1 / 253982 | HGNCID: | 27380 | Length: | 390 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 69/207 - (33%) |
---|---|---|---|
Similarity: | 90/207 - (43%) | Gaps: | 36/207 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 801 PRLRAQPFWQPKETGYERQLEKLTLNWRAI-RDEGLALLGRSGFFEDEAELLRDKGVWQ------ 858
Fly 859 --QYELYAQGRRVKDNCRRAPITCSLLEEFPESAGCRR-------GQVKFSVMQAKTHVWPHCGP 914
Fly 915 TNCRLRAHLTLAAPEPEKASLRVAEQERTWREGELFIFDDSFEHEVWHNGSQS---RLVLILDMW 976
Fly 977 HPQLSAAQRRSL 988 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Asph | NP_001261020.1 | TPR | 610..854 | CDD:223533 | 14/53 (26%) |
TPR repeat | 684..714 | CDD:276809 | |||
TPR repeat | 719..748 | CDD:276809 | |||
TPR repeat | 757..782 | CDD:276809 | |||
Asp_Arg_Hydrox | 826..977 | CDD:282913 | 56/169 (33%) | ||
ASPHD1 | NP_859069.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..54 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 116..143 | ||||
Asp_Arg_Hydrox | 214..372 | CDD:377460 | 57/172 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165156784 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG3555 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.700 |