| Sequence 1: | NP_001261020.1 | Gene: | Asph / 36778 | FlyBaseID: | FBgn0034075 | Length: | 991 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_859069.2 | Gene: | ASPHD1 / 253982 | HGNCID: | 27380 | Length: | 390 | Species: | Homo sapiens |
| Alignment Length: | 207 | Identity: | 69/207 - (33%) |
|---|---|---|---|
| Similarity: | 90/207 - (43%) | Gaps: | 36/207 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 801 PRLRAQPFWQPKETGYERQLEKLTLNWRAI-RDEGLALLGRSGFFEDEAELLRDKGVWQ------ 858
Fly 859 --QYELYAQGRRVKDNCRRAPITCSLLEEFPESAGCRR-------GQVKFSVMQAKTHVWPHCGP 914
Fly 915 TNCRLRAHLTLAAPEPEKASLRVAEQERTWREGELFIFDDSFEHEVWHNGSQS---RLVLILDMW 976
Fly 977 HPQLSAAQRRSL 988 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Asph | NP_001261020.1 | TPR | 610..854 | CDD:223533 | 14/53 (26%) |
| TPR repeat | 684..714 | CDD:276809 | |||
| TPR repeat | 719..748 | CDD:276809 | |||
| TPR repeat | 757..782 | CDD:276809 | |||
| Asp_Arg_Hydrox | 826..977 | CDD:282913 | 56/169 (33%) | ||
| ASPHD1 | NP_859069.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..54 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 116..143 | ||||
| Asp_Arg_Hydrox | 214..372 | CDD:377460 | 57/172 (33%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165156784 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG3555 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.700 | |||||