DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rho1 and RHO4

DIOPT Version :9

Sequence 1:NP_477098.1 Gene:Rho1 / 36775 FlyBaseID:FBgn0014020 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_012981.3 Gene:RHO4 / 853929 SGDID:S000001763 Length:291 Species:Saccharomyces cerevisiae


Alignment Length:198 Identity:97/198 - (48%)
Similarity:132/198 - (66%) Gaps:24/198 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIE-VDGKQVELALWDTAGQEDYDRLR 70
            |:|:|||||.|||||||.:.:..||..|:||:|||||.:|| .:|:.:|||||||||||:|.|||
Yeast    74 KIVVVGDGAVGKTCLLISYVQGTFPTDYIPTIFENYVTNIEGPNGQIIELALWDTAGQEEYSRLR 138

  Fly    71 PLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRDLAKMK 135
            ||||.:.||:::|:||.|..||:|:.:.|.||||||||:.||:|||.|.||....| :.||    
Yeast   139 PLSYTNADVLMVCYSVGSKTSLKNVEDLWFPEVKHFCPSTPIMLVGLKSDLYEADN-LSDL---- 198

  Fly   136 QEPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAALQ------------VK---KRK 185
               |:|....::|:::.|||:::|||:.||.:.:|||||....|.            :|   ||.
Yeast   199 ---VEPSSAESLAKRLGAFAHIQCSARLKENIDEVFETAIHTLLSDSLYAPREPTHTIKNPFKRN 260

  Fly   186 KTR 188
            .||
Yeast   261 TTR 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rho1NP_477098.1 RhoA_like 5..179 CDD:206662 91/172 (53%)
RHO4NP_012981.3 Rho4_like 70..248 CDD:206704 92/181 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.