DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rho1 and rnd2

DIOPT Version :9

Sequence 1:NP_477098.1 Gene:Rho1 / 36775 FlyBaseID:FBgn0014020 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001038829.1 Gene:rnd2 / 751645 ZFINID:ZDB-GENE-030616-177 Length:235 Species:Danio rerio


Alignment Length:190 Identity:87/190 - (45%)
Similarity:128/190 - (67%) Gaps:6/190 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRL 69
            |.|:|:|||..||||.||.||:||.:||.|||||||||.|..|:|..::||.:|||:|...||.:
Zfish     8 RCKVVVVGDTQCGKTALLHVFAKDNYPENYVPTVFENYTASFEIDKHRIELNMWDTSGSSYYDNV 72

  Fly    70 RPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRDLAKM 134
            |||:|||.|.:|:||.:..|::|::|.:||..|.:.:|||..::|||.|.|:|.|.:|:|:|:|.
Zfish    73 RPLAYPDCDAVLICFDISRPETLDSITKKWQVEAQEYCPNAKLVLVGCKLDMRTDVSTLRELSKQ 137

  Fly   135 KQEPVKPQEGRAMAEKINAFAYLECSAK-SKEGVRDVFETATRAALQVK-----KRKKTR 188
            :..||..::|...|.::.|.||:|||:: ....|||||...|..:::.:     ||..:|
Zfish   138 RLIPVTHEQGSLRARELGAVAYVECSSRMCVNSVRDVFHITTLVSVRREPAPSLKRSTSR 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rho1NP_477098.1 RhoA_like 5..179 CDD:206662 84/174 (48%)
rnd2NP_001038829.1 Rnd2_Rho7 8..235 CDD:206736 87/190 (46%)
RHO 11..183 CDD:197554 82/171 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.