DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rho1 and Rhobtb3

DIOPT Version :9

Sequence 1:NP_477098.1 Gene:Rho1 / 36775 FlyBaseID:FBgn0014020 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_082769.1 Gene:Rhobtb3 / 73296 MGIID:1920546 Length:611 Species:Mus musculus


Alignment Length:164 Identity:39/164 - (23%)
Similarity:71/164 - (43%) Gaps:18/164 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VFENYVADIEVDGKQV--ELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWT 100
            ||..|.|....:.|.|  :..:||....:.|.....:.  ..|:|::.::|:...|...:.:.:.
Mouse    54 VFTEYQASAFGNVKLVVHDCPVWDIFDSDWYTSRNLIG--GADIIVIKYNVNDKFSFHEVKDNYI 116

  Fly   101 PEVKHFCPNVPIIL--VGNKKDLRNDPNTIRDLAKMKQEPVKPQEGRAMAEKINAFAYLECSA-- 161
            |.:|....:||:|:  ||.::: ...|.|.......:...|...||..:|:::.| .|||..:  
Mouse   117 PVIKRASNSVPVIIAAVGTRQN-EELPCTCPLCTSDRGSCVTTTEGIQLAKELGA-TYLELHSLD 179

  Fly   162 -----KSKEGVRDVFETAT---RAALQVKKRKKT 187
                 |...||.:.|....   :.:.::||||.|
Mouse   180 DFYIGKYFGGVLEYFMIQALNQKTSEKMKKRKMT 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rho1NP_477098.1 RhoA_like 5..179 CDD:206662 34/154 (22%)
Rhobtb3NP_082769.1 Rho-like 1..175 29/124 (23%)
P-loop_NTPase 34..174 CDD:304359 28/123 (23%)
BTB 413..515 CDD:279045
Interaction with Rab9. /evidence=ECO:0000250 420..611
BTB 421..518 CDD:197585
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.