DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rho1 and 4930544G11Rik

DIOPT Version :9

Sequence 1:NP_477098.1 Gene:Rho1 / 36775 FlyBaseID:FBgn0014020 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001155245.1 Gene:4930544G11Rik / 67653 MGIID:1914903 Length:193 Species:Mus musculus


Alignment Length:192 Identity:151/192 - (78%)
Similarity:169/192 - (88%) Gaps:1/192 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQED 65
            |..||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse     1 MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQED 65

  Fly    66 YDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRD 130
            ||||||||||||||:|:|||:.:|||..|||.||.||||||||||||||||:|||||||..||::
Mouse    66 YDRLRPLSYPDTDVLLLCFSIGNPDSFGNIPHKWIPEVKHFCPNVPIILVGSKKDLRNDFYTIQE 130

  Fly   131 LAKMKQEPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAALQVKK-RKKTRCLL 191
            |||.||.||:|::|:.:|..|.||.|:|||||:|:|||.|||.|||||||..: :|||.|.:
Mouse   131 LAKRKQAPVRPEQGQGLANSIGAFEYVECSAKTKDGVRRVFEKATRAALQTNRVKKKTGCFV 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rho1NP_477098.1 RhoA_like 5..179 CDD:206662 142/173 (82%)
4930544G11RikNP_001155245.1 RhoA_like 5..179 CDD:206662 142/173 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53521
OrthoDB 1 1.010 - - D1166960at2759
OrthoFinder 1 1.000 - - FOG0000943
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101682
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X549
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.790

Return to query results.
Submit another query.