DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rho1 and rhoj

DIOPT Version :9

Sequence 1:NP_477098.1 Gene:Rho1 / 36775 FlyBaseID:FBgn0014020 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001038266.1 Gene:rhoj / 556371 ZFINID:ZDB-GENE-040724-272 Length:226 Species:Danio rerio


Alignment Length:194 Identity:96/194 - (49%)
Similarity:138/194 - (71%) Gaps:6/194 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TTIRK--KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQE 64
            ||.:|  |.|:|||||.||||||:.::.|.|||.|:||||::|..::.|.|:|..|.|:||||||
Zfish    28 TTAKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYIPTVFDHYAVNVTVSGRQHLLGLYDTAGQE 92

  Fly    65 DYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIR 129
            ||::|||||||:|||.|:||||.:|.|..|:.|:|.||::...|:||.||:|.:.|||:||.|:.
Zfish    93 DYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELRSCMPHVPYILIGTQIDLRDDPKTLA 157

  Fly   130 DLAKMKQEPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAALQVKKRKK----TRC 189
            .|.:||::|:..::|..:|.:|.|..||||||.:::|::.||:.|.......||:|:    .||
Zfish   158 RLLQMKEKPLTYEQGLKLAREIGAQCYLECSALTQKGLKTVFDEAILTIFSPKKQKRGCAACRC 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rho1NP_477098.1 RhoA_like 5..179 CDD:206662 89/175 (51%)
rhojNP_001038266.1 P-loop_NTPase 34..207 CDD:304359 88/172 (51%)
RHO 36..209 CDD:197554 87/172 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.