DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rho1 and si:ch211-133l11.10

DIOPT Version :9

Sequence 1:NP_477098.1 Gene:Rho1 / 36775 FlyBaseID:FBgn0014020 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_005160216.1 Gene:si:ch211-133l11.10 / 555552 ZFINID:ZDB-GENE-141219-14 Length:262 Species:Danio rerio


Alignment Length:186 Identity:77/186 - (41%)
Similarity:118/186 - (63%) Gaps:10/186 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQ------ 63
            |.|.|:|||||.|||.|:|.::.:.:|..::||.|:|:.|.:.|||:.|:|.|.|.|||      
Zfish    36 RVKCVMVGDGAVGKTSLIISYTTNGYPAEHIPTAFDNFTARVVVDGRPVQLQLCDMAGQRWEAVD 100

  Fly    64 ----EDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRND 124
                :|:||||||.|.|.||.|:|:||..|.|..::.::|.||:...||.|||||||.:.||..|
Zfish   101 QSLNDDFDRLRPLCYRDADVFLLCYSVVLPSSFRSVTDRWAPEINRICPGVPIILVGTQCDLLED 165

  Fly   125 PNTIRDLAKMKQEPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAALQ 180
            ...:..||:.:::||..::.|..|..|.|..:.||||.:::.:::||:.|..|:::
Zfish   166 VQVLIRLAEGQEKPVSQEDARLCARSIGAVTFAECSALTQKNLKEVFDAAILASMK 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rho1NP_477098.1 RhoA_like 5..179 CDD:206662 77/183 (42%)
si:ch211-133l11.10XP_005160216.1 Wrch_1 37..219 CDD:133330 75/181 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.