DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rho1 and RHOF

DIOPT Version :9

Sequence 1:NP_477098.1 Gene:Rho1 / 36775 FlyBaseID:FBgn0014020 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_061907.2 Gene:RHOF / 54509 HGNCID:15703 Length:211 Species:Homo sapiens


Alignment Length:191 Identity:99/191 - (51%)
Similarity:131/191 - (68%) Gaps:5/191 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRP 71
            |:||||||.||||.||:|:|:..|||.|.|:|||.|.|.:.|..|:|.|.|:|||||||||||||
Human    21 KIVIVGDGGCGKTSLLMVYSQGSFPEHYAPSVFEKYTASVTVGSKEVTLNLYDTAGQEDYDRLRP 85

  Fly    72 LSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRDLAKMKQ 136
            |||.:|.::|:|:.|.:|.|.:|:..||.|||.|||..:|::|:|.|.|||.|...:|.|...:.
Human    86 LSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQL 150

  Fly   137 EPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAAL----QVKKRKKTR-CLLL 192
            ||:...:|.:..|:|.|..|||||||.:|.|.|||..|.:.||    :.:::||.| ||||
Human   151 EPITYMQGLSACEQIRAALYLECSAKFRENVEDVFREAAKVALSALKKAQRQKKRRLCLLL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rho1NP_477098.1 RhoA_like 5..179 CDD:206662 90/171 (53%)
RHOFNP_061907.2 Rho4_like 17..211 CDD:206704 97/189 (51%)
RHO 22..195 CDD:197554 91/172 (53%)
Effector region. /evidence=ECO:0000255 48..56 5/7 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.