DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rho1 and rhoaa

DIOPT Version :9

Sequence 1:NP_477098.1 Gene:Rho1 / 36775 FlyBaseID:FBgn0014020 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_998302.1 Gene:rhoaa / 406411 ZFINID:ZDB-GENE-040426-2150 Length:193 Species:Danio rerio


Alignment Length:193 Identity:171/193 - (88%)
Similarity:178/193 - (92%) Gaps:1/193 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQED 65
            |..||||||||||||||||||||||||||||||||||||||||||||||.|||||||||||||||
Zfish     1 MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQED 65

  Fly    66 YDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRD 130
            ||||||||||||||||||||:||||||||||||||||||||||||||||||||||||||.:|.|:
Zfish    66 YDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRE 130

  Fly   131 LAKMKQEPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAALQVKKR-KKTRCLLL 192
            |.|||||||||:|||.||.:||||.|||||||:|||||:|||.|||||||.||| ||..|.||
Zfish   131 LQKMKQEPVKPEEGRDMANRINAFGYLECSAKTKEGVREVFEMATRAALQAKKRGKKNACALL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rho1NP_477098.1 RhoA_like 5..179 CDD:206662 158/173 (91%)
rhoaaNP_998302.1 RhoA_like 5..179 CDD:206662 158/173 (91%)
RHO 8..181 CDD:197554 157/172 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581999
Domainoid 1 1.000 329 1.000 Domainoid score I1138
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H90945
Inparanoid 1 1.050 350 1.000 Inparanoid score I2249
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1166960at2759
OrthoFinder 1 1.000 - - FOG0000943
OrthoInspector 1 1.000 - - otm24996
orthoMCL 1 0.900 - - OOG6_101682
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X549
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.760

Return to query results.
Submit another query.