DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rho1 and RHOH

DIOPT Version :9

Sequence 1:NP_477098.1 Gene:Rho1 / 36775 FlyBaseID:FBgn0014020 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001265288.1 Gene:RHOH / 399 HGNCID:686 Length:191 Species:Homo sapiens


Alignment Length:184 Identity:77/184 - (41%)
Similarity:110/184 - (59%) Gaps:7/184 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRP 71
            |.|:|||.|.|||.||:.|:.:.|||.|.|||:||...|:.:||.|:.|.||||||.:.:..:||
Human     6 KCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRP 70

  Fly    72 LSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRDLAKMKQ 136
            |||...||:|||:||.:.:|..|:..||..|::...|..|:::|..:.|.       |::...:.
Human    71 LSYQQADVVLMCYSVANHNSFLNLKNKWIGEIRSNLPCTPVLVVATQTDQ-------REMGPHRA 128

  Fly   137 EPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAALQVKKRKKTRCL 190
            ..|...||:.:|:.:.|..||||||.|..||:.|||.|.|.|:...:|:..|.|
Human   129 SCVNAMEGKKLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRRL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rho1NP_477098.1 RhoA_like 5..179 CDD:206662 73/171 (43%)
RHOHNP_001265288.1 Rho 5..169 CDD:206641 72/169 (43%)
Effector region. /evidence=ECO:0000250 33..41 5/7 (71%)
Interaction with ZAP70. /evidence=ECO:0000250 73..86 7/12 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.