DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rho1 and RHOC

DIOPT Version :9

Sequence 1:NP_477098.1 Gene:Rho1 / 36775 FlyBaseID:FBgn0014020 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001036143.1 Gene:RHOC / 389 HGNCID:669 Length:193 Species:Homo sapiens


Alignment Length:193 Identity:165/193 - (85%)
Similarity:178/193 - (92%) Gaps:1/193 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQED 65
            |..|||||||||||||||||||||||||||||||||||||||:||||||||||||||||||||||
Human     1 MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQED 65

  Fly    66 YDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRD 130
            ||||||||||||||||||||:||||||||||||||||||||||||||||||||||||.|.:|.|:
Human    66 YDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRE 130

  Fly   131 LAKMKQEPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAALQVKKRKKTR-CLLL 192
            |||||||||:.:|||.||.:|:||.|||||||:|||||:|||.||||.|||:|.|:.| |.:|
Human   131 LAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rho1NP_477098.1 RhoA_like 5..179 CDD:206662 155/173 (90%)
RHOCNP_001036143.1 RhoA_like 5..179 CDD:206662 155/173 (90%)
Effector region. /evidence=ECO:0000255 34..42 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148071
Domainoid 1 1.000 329 1.000 Domainoid score I1156
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H90945
Inparanoid 1 1.050 346 1.000 Inparanoid score I2316
Isobase 1 0.950 - 0 Normalized mean entropy S71
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1166960at2759
OrthoFinder 1 1.000 - - FOG0000943
OrthoInspector 1 1.000 - - otm42106
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X549
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.