DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rho1 and Cdc42

DIOPT Version :9

Sequence 1:NP_477098.1 Gene:Rho1 / 36775 FlyBaseID:FBgn0014020 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001245762.1 Gene:Cdc42 / 32981 FlyBaseID:FBgn0010341 Length:191 Species:Drosophila melanogaster


Alignment Length:193 Identity:100/193 - (51%)
Similarity:138/193 - (71%) Gaps:3/193 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQED 65
            |.||  |.|:|||||.|||||||.::.::||..||||||:||...:.:.|:...|.|:|||||||
  Fly     1 MQTI--KCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQED 63

  Fly    66 YDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRD 130
            ||||||||||.|||.|:||||.||.|.||:.|||.||:.|.|...|.:|||.:.|||::.:|:..
  Fly    64 YDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEK 128

  Fly   131 LAKMKQEPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAALQ-VKKRKKTRCLLL 192
            |||.||:|:..::|..:|:::.|..|:||||.:::|:::||:.|..|||: .:..||.:|..|
  Fly   129 LAKNKQKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPPEPTKKRKCKFL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rho1NP_477098.1 RhoA_like 5..179 CDD:206662 91/173 (53%)
Cdc42NP_001245762.1 Cdc42 3..177 CDD:206664 93/175 (53%)
RHO 6..179 CDD:197554 92/172 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466338
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.