DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rho1 and RhoU

DIOPT Version :9

Sequence 1:NP_477098.1 Gene:Rho1 / 36775 FlyBaseID:FBgn0014020 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster


Alignment Length:168 Identity:68/168 - (40%)
Similarity:100/168 - (59%) Gaps:3/168 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRP 71
            |.|:|||||.|||.|::.:.:::|...::||..:.|.||:.|:...|.|.:.|||||:..|.||.
  Fly   394 KCVLVGDGAVGKTNLILSYLENRFNPEHIPTASDIYNADVNVNESPVHLTICDTAGQDTLDPLRE 458

  Fly    72 LSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRDLAKMKQ 136
            |.|||:||.|:||||..|::...|..||.|  |.......:||||.:.|||..||.:..|....:
  Fly   459 LCYPDSDVFLLCFSVVKPETFRAIKTKWAP--KFAKTKAALILVGTQADLRTSPNVLNKLQTNGE 521

  Fly   137 EPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETA 174
            |.:...:...:|..|.| .|:|.|:.:::.|:|||:||
  Fly   522 EAISYADAWDLATTIGA-KYIETSSATQDKVKDVFDTA 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rho1NP_477098.1 RhoA_like 5..179 CDD:206662 68/168 (40%)
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 68/168 (40%)
RHO 395..559 CDD:197554 67/167 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.