DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rho1 and Rhod

DIOPT Version :9

Sequence 1:NP_477098.1 Gene:Rho1 / 36775 FlyBaseID:FBgn0014020 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001099793.1 Gene:Rhod / 293660 RGDID:1310985 Length:210 Species:Rattus norvegicus


Alignment Length:173 Identity:93/173 - (53%)
Similarity:118/173 - (68%) Gaps:0/173 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRP 71
            |:|:||||.||||.|::||:...|||.|.|||||.|.|.:::.||.|.|.:||||||:|||||||
  Rat    19 KVVLVGDGGCGKTSLMMVFANGAFPESYNPTVFERYNATLQMKGKPVRLQIWDTAGQDDYDRLRP 83

  Fly    72 LSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRDLAKMKQ 136
            |.|||.:|:|:||.|.:|:|.:|:..:|.|||.|||..||||:||.|.|||.|...:..|.|.:.
  Rat    84 LFYPDANVLLLCFDVTNPNSFDNVSNRWYPEVTHFCKGVPIIVVGCKIDLRKDKVLVNTLRKKRL 148

  Fly   137 EPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAAL 179
            |||....|..||..:.|.|||||||:..:.|..||:.|...||
  Rat   149 EPVTYHRGHDMARSVGAVAYLECSARLHDNVEAVFQEAAEVAL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rho1NP_477098.1 RhoA_like 5..179 CDD:206662 91/171 (53%)
RhodNP_001099793.1 Rho4_like 16..210 CDD:206704 93/173 (54%)
RHO 20..192 CDD:197554 92/172 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1166960at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.