DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rho1 and rho2

DIOPT Version :9

Sequence 1:NP_477098.1 Gene:Rho1 / 36775 FlyBaseID:FBgn0014020 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_594569.1 Gene:rho2 / 2542773 PomBaseID:SPAC16.01 Length:200 Species:Schizosaccharomyces pombe


Alignment Length:193 Identity:109/193 - (56%)
Similarity:140/193 - (72%) Gaps:4/193 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDR 68
            ||:|||:|||||||||.||.||:...||..||||||||||:|..||||.|:||||||||||:|:|
pombe     7 IRRKLVVVGDGACGKTSLLSVFTLGYFPTEYVPTVFENYVSDCRVDGKSVQLALWDTAGQEEYER 71

  Fly    69 LRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRDLAK 133
            |||:||....:||:.|::||||||||:..||..|:...|||||.||||.|.|||:||..|.::.:
pombe    72 LRPMSYAKAHIILVGFAIDSPDSLENVSTKWIEEINTLCPNVPFILVGMKADLRSDPVAIEEMRR 136

  Fly   134 MKQEPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAALQVK----KRKKTRCLLL 192
            ..|..||.|:...:|::|.|..|:|||:.:.:||.||||.||||||.|:    .:..|:|.::
pombe   137 RNQNFVKSQQAELVAQRIGARKYMECSSLTGDGVDDVFEAATRAALTVRDSENDKSSTKCCII 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rho1NP_477098.1 RhoA_like 5..179 CDD:206662 103/173 (60%)
rho2NP_594569.1 Rho2 8..199 CDD:206702 108/190 (57%)
RHO 11..183 CDD:197554 102/171 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.