Sequence 1: | NP_477098.1 | Gene: | Rho1 / 36775 | FlyBaseID: | FBgn0014020 | Length: | 192 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001153508.1 | Gene: | RHOBTB2 / 23221 | HGNCID: | 18756 | Length: | 749 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 73/196 - (37%) |
---|---|---|---|
Similarity: | 107/196 - (54%) | Gaps: | 26/196 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 KLVIVGDGACGKTCLL------IVFSKDQFPEVYVPTVF--ENYVADIE--------VDGKQVEL 55
Fly 56 ALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD 120
Fly 121 LR-NDPNTIRDLAKMKQEPVKPQE------GRAMAEKINAFAYLECSAKSKEGVRDVFETATRAA 178
Fly 179 L 179 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rho1 | NP_477098.1 | RhoA_like | 5..179 | CDD:206662 | 71/194 (37%) |
RHOBTB2 | NP_001153508.1 | RhoBTB | 35..229 | CDD:133275 | 70/193 (36%) |
RHO | 39..230 | CDD:197554 | 70/193 (36%) | ||
BTB | 280..>327 | CDD:295341 | |||
BTB | <443..492 | CDD:197585 | |||
BTB | <443..490 | CDD:295341 | |||
BTB | 513..615 | CDD:279045 | |||
BTB | 523..615 | CDD:197585 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0393 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |