DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rho1 and Rnd1

DIOPT Version :9

Sequence 1:NP_477098.1 Gene:Rho1 / 36775 FlyBaseID:FBgn0014020 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_766200.1 Gene:Rnd1 / 223881 MGIID:2444878 Length:232 Species:Mus musculus


Alignment Length:177 Identity:79/177 - (44%)
Similarity:122/177 - (68%) Gaps:1/177 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDR 68
            :|.|||:|||..||||.:|.|.:||.:||.|||||||||.|.:|.:.::|||:||||:|...||.
Mouse    12 VRCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTSGSPYYDN 76

  Fly    69 LRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRDLAK 133
            :|||.|.|:|.:|:||.:..|:::::..:||..|:..:||:..::|:|.|.|||.|.:|:.:|:.
Mouse    77 VRPLCYSDSDAVLLCFDISRPETMDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELSH 141

  Fly   134 MKQEPVKPQEGRAMAEKINAFAYLECSA-KSKEGVRDVFETATRAAL 179
            .||.|:..::|.|:|:::.|..|||.|| .|:..:..:|.||:...|
Mouse   142 QKQAPISYEQGCAIAKQLGAEIYLEGSAFTSETSIHSIFRTASMVCL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rho1NP_477098.1 RhoA_like 5..179 CDD:206662 78/174 (45%)
Rnd1NP_766200.1 P-loop_NTPase 1..232 CDD:304359 79/177 (45%)
RHO 16..190 CDD:197554 77/173 (45%)
Effector region. /evidence=ECO:0000255 42..50 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.