DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rho1 and chw-1

DIOPT Version :9

Sequence 1:NP_477098.1 Gene:Rho1 / 36775 FlyBaseID:FBgn0014020 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_505686.1 Gene:chw-1 / 184848 WormBaseID:WBGene00009059 Length:207 Species:Caenorhabditis elegans


Alignment Length:184 Identity:66/184 - (35%)
Similarity:103/184 - (55%) Gaps:14/184 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRP 71
            |.:.||:.|.|||.:::.::.:.:|..||||.|:|:...:.||.|.:.|.|.|||||..:|.|||
 Worm    11 KCIFVGNAAVGKTSMIVSYTTNVYPHNYVPTAFDNFSVVVLVDKKPIRLQLHDTAGQSSFDTLRP 75

  Fly    72 LSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRND--PNTIRDLAKM 134
            |.|.|.||.::.:||....|.|::...|.|||....|...:||||.:.|.|..  .||:..|   
 Worm    76 LCYTDADVFVIVYSVVDLQSFEDVSHHWYPEVTKRNPGTKLILVGTQADQRWQVRGNTVTQL--- 137

  Fly   135 KQEPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAALQVKKRKKTR 188
                    .|:|:|:::.| .:.||||.::..::.:|:.|..|.|:.||.::.|
 Worm   138 --------RGKALADRLGA-EFFECSALTQHNLKQMFDAAILAGLEGKKNREKR 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rho1NP_477098.1 RhoA_like 5..179 CDD:206662 62/173 (36%)
chw-1NP_505686.1 Wrch_1 10..172 CDD:133330 61/172 (35%)
RHO 12..174 CDD:197554 61/173 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.