DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rho1 and Rhov

DIOPT Version :9

Sequence 1:NP_477098.1 Gene:Rho1 / 36775 FlyBaseID:FBgn0014020 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_038960142.1 Gene:Rhov / 171581 RGDID:628824 Length:281 Species:Rattus norvegicus


Alignment Length:195 Identity:87/195 - (44%)
Similarity:125/195 - (64%) Gaps:12/195 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRP 71
            |.|:|||||.||:.|::.::.:.:|..|.||..:.:...:.|||..|.:.|||||||||:||||.
  Rat    78 KCVLVGDGAVGKSSLIVSYTCNGYPSRYRPTALDTFSVQVLVDGAPVRIELWDTAGQEDFDRLRS 142

  Fly    72 LSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRDLAKMKQ 136
            |.||||||.|.||||..|.|.:||.|||.||::...|..|::|||.:.|||:|.|.:..|.:..:
  Rat   143 LCYPDTDVFLACFSVVQPSSFQNITEKWLPEIRTHNPQAPVLLVGTQADLRDDVNVLIQLDQGGR 207

  Fly   137 E-PVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAALQVKKR--KK---------TRC 189
            | ||...:.:.:||||.|..||||||.:::.:::||::|..:|::.|.|  ||         :||
  Rat   208 EGPVPEPQAQGLAEKIRACCYLECSALTQKNLKEVFDSAILSAIEHKARLEKKLNAKGVRTLSRC 272

  Fly   190  189
              Rat   273  272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rho1NP_477098.1 RhoA_like 5..179 CDD:206662 80/172 (47%)
RhovXP_038960142.1 Wrch_1 77..250 CDD:133330 80/171 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.