Sequence 1: | NP_477098.1 | Gene: | Rho1 / 36775 | FlyBaseID: | FBgn0014020 | Length: | 192 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_598378.3 | Gene: | RHOV / 171177 | HGNCID: | 18313 | Length: | 236 | Species: | Homo sapiens |
Alignment Length: | 195 | Identity: | 87/195 - (44%) |
---|---|---|---|
Similarity: | 125/195 - (64%) | Gaps: | 12/195 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRP 71
Fly 72 LSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRDLAKMKQ 136
Fly 137 E-PVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAALQVKKR--KK---------TRC 189
Fly 190 189 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rho1 | NP_477098.1 | RhoA_like | 5..179 | CDD:206662 | 80/172 (47%) |
RHOV | NP_598378.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..27 | ||
Wrch_1 | 32..205 | CDD:133330 | 80/171 (47%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0393 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |