DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rho1 and Rhod

DIOPT Version :9

Sequence 1:NP_477098.1 Gene:Rho1 / 36775 FlyBaseID:FBgn0014020 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_031511.1 Gene:Rhod / 11854 MGIID:108446 Length:210 Species:Mus musculus


Alignment Length:190 Identity:98/190 - (51%)
Similarity:128/190 - (67%) Gaps:6/190 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRP 71
            |:|:||||.||||.|::||:|..|||.|.|||||.|.|.:::.||.|.|.:||||||:|||||||
Mouse    19 KVVLVGDGGCGKTSLMMVFAKGAFPESYSPTVFERYNATLQMKGKPVHLQIWDTAGQDDYDRLRP 83

  Fly    72 LSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRDLAKMKQ 136
            |.|||.:|:|:||.|.:|:|.:|:..:|.|||.|||..||||:||.|.|||.|...:.:|.|.:.
Mouse    84 LFYPDANVLLLCFDVTNPNSFDNVSNRWYPEVTHFCKGVPIIVVGCKIDLRKDKVLVNNLRKKRL 148

  Fly   137 EPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAALQVKK----RKKTR--CL 190
            |||....|..||..:.|.|||||||:..:.|..||:.|...||..::    |:.|:  ||
Mouse   149 EPVTYHRGHDMARSVGAVAYLECSARLHDNVEAVFQEAAEVALSSRRHNFWRRITQNCCL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rho1NP_477098.1 RhoA_like 5..179 CDD:206662 92/171 (54%)
RhodNP_031511.1 Rho4_like 17..208 CDD:206704 96/188 (51%)
RHO 20..192 CDD:197554 92/171 (54%)
Effector region. /evidence=ECO:0000255 46..54 6/7 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1166960at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.