DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rho1 and Rhob

DIOPT Version :9

Sequence 1:NP_477098.1 Gene:Rho1 / 36775 FlyBaseID:FBgn0014020 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_031509.1 Gene:Rhob / 11852 MGIID:107949 Length:196 Species:Mus musculus


Alignment Length:190 Identity:156/190 - (82%)
Similarity:171/190 - (90%) Gaps:0/190 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQED 65
            |..||||||:||||||||||||||||||:||||||||||||||||||||||||||||||||||||
Mouse     1 MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQED 65

  Fly    66 YDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRD 130
            ||||||||||||||||||||||||||||||||||.|||||||||||||||.||||||:|.:...:
Mouse    66 YDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTE 130

  Fly   131 LAKMKQEPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAALQVKKRKKTRCL 190
            ||:||||||:..:|||||.:|.|:.|||||||:|||||:|||||||||||.:...:..|:
Mouse   131 LARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCI 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rho1NP_477098.1 RhoA_like 5..179 CDD:206662 150/173 (87%)
RhobNP_031509.1 RhoA_like 5..179 CDD:206662 150/173 (87%)
Effector region. /evidence=ECO:0000255 34..42 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838166
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1166960at2759
OrthoFinder 1 1.000 - - FOG0000943
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101682
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X549
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.710

Return to query results.
Submit another query.