DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rho1 and Rhoa

DIOPT Version :9

Sequence 1:NP_477098.1 Gene:Rho1 / 36775 FlyBaseID:FBgn0014020 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_476473.1 Gene:Rhoa / 117273 RGDID:619921 Length:193 Species:Rattus norvegicus


Alignment Length:193 Identity:167/193 - (86%)
Similarity:181/193 - (93%) Gaps:1/193 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQED 65
            |..||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat     1 MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQED 65

  Fly    66 YDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRD 130
            ||||||||||||||||||||:||||||||||||||||||||||||||||||||||||||.:|.|:
  Rat    66 YDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRE 130

  Fly   131 LAKMKQEPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAALQVKK-RKKTRCLLL 192
            |||||||||||:|||.||.:|.||.|:|||||:|:|||:|||.|||||||.:: :||:.||:|
  Rat   131 LAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLIL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rho1NP_477098.1 RhoA_like 5..179 CDD:206662 157/173 (91%)
RhoaNP_476473.1 RhoA_like 5..179 CDD:206662 157/173 (91%)
Effector region. /evidence=ECO:0000255 34..42 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341947
Domainoid 1 1.000 328 1.000 Domainoid score I1135
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 345 1.000 Inparanoid score I2247
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1166960at2759
OrthoFinder 1 1.000 - - FOG0000943
OrthoInspector 1 1.000 - - oto98507
orthoMCL 1 0.900 - - OOG6_101682
Panther 1 1.100 - - LDO PTHR24072
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X549
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.