DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rho1 and rhoq

DIOPT Version :9

Sequence 1:NP_477098.1 Gene:Rho1 / 36775 FlyBaseID:FBgn0014020 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_031757763.1 Gene:rhoq / 100497782 XenbaseID:XB-GENE-492072 Length:205 Species:Xenopus tropicalis


Alignment Length:189 Identity:97/189 - (51%)
Similarity:137/189 - (72%) Gaps:5/189 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRP 71
            |.|:|||||.||||||:.::.|.|||.||||||::|...:.|.|:|..|.|:|||||||||||||
 Frog    11 KCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGRQYLLGLYDTAGQEDYDRLRP 75

  Fly    72 LSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRDLAKMKQ 136
            ||||.|||.|:||||.:|.|.:|:.|:|.||:|.:.||||.:|||.:.|||:||.|:..|..:|:
 Frog    76 LSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLVGTQIDLRDDPKTLAKLNDVKE 140

  Fly   137 EPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAAL-----QVKKRKKTRCL 190
            :|:..::|..:|::|.|..|:||||.:::|::.||:.:..|.|     .:|||..:||:
 Frog   141 KPITVEQGHKLAKEIGACCYVECSALTQKGLKTVFDESIIAILTPKKTAMKKRLGSRCI 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rho1NP_477098.1 RhoA_like 5..179 CDD:206662 91/171 (53%)
rhoqXP_031757763.1 Tc10 10..183 CDD:206707 91/171 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.