DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rho1 and rhoj

DIOPT Version :9

Sequence 1:NP_477098.1 Gene:Rho1 / 36775 FlyBaseID:FBgn0014020 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_017952315.1 Gene:rhoj / 100125013 XenbaseID:XB-GENE-957540 Length:214 Species:Xenopus tropicalis


Alignment Length:192 Identity:97/192 - (50%)
Similarity:138/192 - (71%) Gaps:3/192 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTIRK--KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQ 63
            |:::::  |.|:|||||.||||||:.::.|.|||.||||||::|...|.|.|||..|.|:|||||
 Frog    15 MSSMKRMLKCVVVGDGAVGKTCLLMSYANDAFPEQYVPTVFDHYAVTITVGGKQYLLGLYDTAGQ 79

  Fly    64 EDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTI 128
            ||||:|||||||:|||.|:||||.:|.|..|:.|:|..|::...|:||.:|:|.:.|||:||.|:
 Frog    80 EDYDQLRPLSYPNTDVFLICFSVVNPASYHNVHEEWVSELRACMPHVPYVLIGTQIDLRDDPITL 144

  Fly   129 RDLAKMKQEPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAALQVKKRKKTRCL 190
            ..|..||::|:..::|..:|:.|.|..||||||.:::|:::||:.|.......|| ||.||:
 Frog   145 ARLLHMKEKPITQEQGMKLAKMIGAQCYLECSALTQKGLKNVFDEAILTVFHPKK-KKRRCV 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rho1NP_477098.1 RhoA_like 5..179 CDD:206662 90/175 (51%)
rhojXP_017952315.1 Tc10 22..195 CDD:206707 90/172 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.