DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dg and dgn-3

DIOPT Version :9

Sequence 1:NP_788363.1 Gene:Dg / 36773 FlyBaseID:FBgn0034072 Length:1262 Species:Drosophila melanogaster
Sequence 2:NP_508319.3 Gene:dgn-3 / 184149 WormBaseID:WBGene00017221 Length:248 Species:Caenorhabditis elegans


Alignment Length:269 Identity:60/269 - (22%)
Similarity:106/269 - (39%) Gaps:73/269 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   935 WLQFDSKNEEFYGIPKSGDIGSEEYLLVAEDSGGLSAHDALVVVVSPAPKRDFGFFFKAY----L 995
            |. :.:...|..|||...  |:.|||:                     ..::....|:.:    :
 Worm    15 WF-YQTLPNELSGIPLVA--GTSEYLV---------------------NNKNMEILFEVHVRENV 55

  Fly   996 SIKHERFNADLQRKFVERVAKLNGDPTTGQIQIRSITTHHD-SDGTIVNFY-------NTTLYRK 1052
            :.|| ||:..|.|..||::.   |.|.|..|.:..:....: |..:|:|..       |.|:...
 Worm    56 TPKH-RFSLVLLRPTVEQML---GFPRTRVIFLEFLANAMNISSISILNIEYIRLSPDNMTIVSF 116

  Fly  1053 HNSCREKEVAMTRSVY------LNSDLSLREAAKRALGPELNLTNFSVVPFSIC--HHTENIDTN 1109
            ||:.::.|:....|.:      .|:|.||::|...::.|:.::.:.:...|..|  |.|..:.|:
 Worm   117 HNNSKDSELCDFNSFHSMLTKMTNTDGSLKDAFVLSMFPDYSVHSLTFERFEECADHPTSQLPTS 181

  Fly  1110 QLDYIPSRPEEPTHKSSFGEDYMITFVWPIVII-----VAMLVAASIIACCLHWCRQRSGKMELG 1169
                :|:    |:     ||..::.|   ||:.     :|||.....|  ||.....|:.|...|
 Worm   182 ----MPA----PS-----GEQIVLYF---IVLFGASYGLAMLFYGCYI--CLSRQIDRAQKRSAG 228

  Fly  1170 DEEERKSFR 1178
              ...|::|
 Worm   229 --RIHKNYR 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DgNP_788363.1 alpha_DG_C 60..190 CDD:206765
Dystroglycan_repeat 654..758 CDD:206636
Dystroglycan_repeat 885..986 CDD:206636 9/50 (18%)
DAG1 989..1262 CDD:283181 51/215 (24%)
dgn-3NP_508319.3 DAG1 80..>185 CDD:310214 22/112 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3781
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.