DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP2353 and HSPG2

DIOPT Version :10

Sequence 1:NP_611082.2 Gene:SP2353 / 36771 FlyBaseID:FBgn0034070 Length:1361 Species:Drosophila melanogaster
Sequence 2:XP_011539620.1 Gene:HSPG2 / 3339 HGNCID:5273 Length:4574 Species:Homo sapiens


Alignment Length:1443 Identity:295/1443 - (20%)
Similarity:451/1443 - (31%) Gaps:569/1443 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 NSLDGRGKSDEDVLYQKGASFSAKLANDDGGKSMAKSTFALSAAQ----------------SASP 138
            :||.||..:..::|:.:.|      |.:|.|:...:.|..:.:|:                ::.|
Human  3520 SSLPGRATARNELLHFERA------APEDSGRYRCRVTNKVGSAEAFAQLLVQGPPGSLPATSIP 3578

  Fly   139 AGNE-----NGEDESGSEGDSYDY------------------GELEDSNSETQEQKQKSLNLQQQ 180
            ||:.     ..:.|:.|.|.|.::                  |:|...:| .|:...:..||.|.
Human  3579 AGSTPTVQVTPQLETKSIGASVEFHCAVPSDRGTQLRWFKEGGQLPPGHS-VQDGVLRIQNLDQS 3642

  Fly   181 ----------------QQQQQKV------------NSNDYYISAESINFNSESEGQEQQDVADFK 217
                            |...|.|            .|....:...::.|...:.|..:..|...|
Human  3643 CQGTYICQAHGPWGKAQASAQLVIQALPSVLINIRTSVQTVVVGHAVEFECLALGDPKPQVTWSK 3707

  Fly   218 AASTMLPSSVP----------PTPSRSTTRATASTTTTTTTT------RRSPTRAPKQRVDVDYG 266
            ....:.|..|.          ........|.||:....||.:      :..|..:..|.|.|..|
Human  3708 VGGHLRPGIVQSGGVVRIAHVELADAGQYRCTATNAAGTTQSHVLLLVQALPQISMPQEVRVPAG 3772

  Fly   267 ---------EGDGSDDYSYSYKSDMSVYDD--VNNNQLNLRRNSKSQTYQQTSNTNTAKNRRKYP 320
                     .|..:.|.|:| |.|.|:..|  :.||.|.|                        |
Human  3773 SAAVFPCIASGYPTPDISWS-KLDGSLPPDSRLENNMLML------------------------P 3812

  Fly   321 NVTSNKVQMHITRETNRLENISAAEPAVVGAAMTTDRSTPTCNLDCGSDGICALEATAASSRCLC 385
            :|.......::...|||...:.|.                                         
Human  3813 SVRPQDAGTYVCTATNRQGKVKAF----------------------------------------- 3836

  Fly   386 PFGKTGNGCQEDIRAH-------VPRFAKR--SWLAFPALHGAYKHVQLRIEFRPESFDGIILLS 441
                          ||       ||.|.:.  |:|..|.:..||:..:::|.|||:|.||::|.:
Human  3837 --------------AHLQVPERVVPYFTQTPYSFLPLPTIKDAYRKFEIKITFRPDSADGMLLYN 3887

  Fly   442 GER------DDLTG---DFMALLLNKGFVEFWFDCGSGVGSVRSRETILLNEWNSVIIYRHRWDA 497
            |::      .:|..   ||::..|..|..||.||.|||:.::|....:.|..:::|.:.|.....
Human  3888 GQKRVPGSPTNLANRQPDFISFGLVGGRPEFRFDAGSGMATIRHPTPLALGHFHTVTLLRSLTQG 3952

  Fly   498 WLVLNHGTKVQGRSNGLFSRITFREPVFLGGIGNITGLAKRLPLAEGFAGCIR--RFVANE---H 557
            .|::.....|.|.|.|.|..:...|.::|||..:. |...:..|:.||.||:|  |....|   |
Human  3953 SLIVGDLAPVNGTSQGKFQGLDLNEELYLGGYPDY-GAIPKAGLSSGFIGCVRELRIQGEEIVFH 4016

  Fly   558 DYKFTEHPLGDVINGFDIQDCSTDKCVRYPCQHGGKCLPSDQGA-ICLCPIGFVGDLCE------ 615
            |...|.|         .|..|.|  |...|||:||:|..|:..: :|:||.||.|..||      
Human  4017 DLNLTAH---------GISHCPT--CRDRPCQNGGQCHDSESSSYVCVCPAGFTGSRCEHSQALH 4070

  Fly   616 -------------------------------IRMD----LQVPAFNGSSFLRYAPLGDSALIWLE 645
                                           :|.:    :..|:.:|:......|...:....|.
Human  4071 CHPEACGPDATCVNRPDGRGYTCRCHLGRSGLRCEEGVTVTTPSLSGAGSYLALPALTNTHHELR 4135

  Fly   646 LKVTLKPEQADGLILYSGPEHR--GDFIALYLNDGFVEFAFDLGSGPALVRSEHSLSLGQWHTIK 708
            |.|..||...||::|:||.:..  .||::|.:..|.:||.::||||.|::||...|:||:||.:.
Human  4136 LDVEFKPLAPDGVLLFSGGKSGPVEDFVSLAMVGGHLEFRYELGSGLAVLRSAEPLALGRWHRVS 4200

  Fly   709 ISRTARLAVLKVDKHQEVLTISSNGFWHLSLDQNLFVGGVNHVDRLPLDLKYKPFFVGCIQRIDI 773
            ..|..:...|:|:..:.||..|......|:|...|::|||.....|.........|.||:..:.:
Human  4201 AERLNKDGSLRVNGGRPVLRSSPGKSQGLNLHTLLYLGGVEPSVPLSPATNMSAHFRGCVGEVSV 4265

  Fly   774 NGHSLGIVAEALGGSNIGNC--PHACVARPCGPLAECVPQMESYE----CRCSIHNERCNKAAEV 832
            ||..|.:....||...||.|  ...|..:||...|.|:|..| ||    ||.....:.|..  |.
Human  4266 NGKRLDLTYSFLGSQGIGQCYDSSPCERQPCQHGATCMPAGE-YEFQCLCRDGFKGDLCEH--EE 4327

  Fly   833 PPEQLPELALHKSKVLETKDNGEAAKKVSGLAHKKHSKKHRNLHKPTPATSTTTSTTSTTTTTTE 897
            .|.||.|..||......|:                                              
Human  4328 NPCQLREPCLHGGTCQGTR---------------------------------------------- 4346

  Fly   898 APSERTEEATAGALSNEEIEDDIIFRLVQQQQQQKELKKQHQQTTTTAPATSTTSSGPSKAKPRL 962
                                                                      ....|..
Human  4347 ----------------------------------------------------------CLCLPGF 4353

  Fly   963 SGKHHASKHEHHLKPNAAFTRKLSRLPTHYESFQTNPDSDILTFEDNNDWVTSLQQQEYGDAMAA 1027
            ||                                                               
Human  4354 SG--------------------------------------------------------------- 4355

  Fly  1028 SQVPLAFEDASPGTPRSSDNNEDDENAFVFDESLFDASDGTEEYQRKQLAQDMKRIMSNSNAHSS 1092
                          ||....                                           |.
Human  4356 --------------PRCQQG-------------------------------------------SG 4363

  Fly  1093 HKKAEVQFPPQGSQEVGTANEDTSQYSDDYNDDELLTPVMQGGEEVKLEQHTSSTPQTHTDWSLL 1157
            |..||..:..:||    ..|:...||...::||..|                             
Human  4364 HGIAESDWHLEGS----GGNDAPGQYGAYFHDDGFL----------------------------- 4395

  Fly  1158 KKFDLSAEHQSQVQGVRKNFGACFAGSDSYFHYNDADTMSQVISYSI-----DLNLRIKTHSENG 1217
                                  .|.|              .|.|.|:     .:.|.::|.:.:|
Human  4396 ----------------------AFPG--------------HVFSRSLPEVPETIELEVRTSTASG 4424

  Fly  1218 VILWTGRQ-GTTEEHDDYLSLGIEQGYLHFRYDLGSGEVDIRFNGTKVSDGLWHRVRAIRNSQEG 1281
            ::||.|.: |...:..|::|||::.|:|.|||.|||||..: .:...::||.||||.|:|..:.|
Human  4425 LLLWQGVEVGEAGQGKDFISLGLQDGHLVFRYQLGSGEARL-VSEDPINDGEWHRVTALREGRRG 4488

  Fly  1282 YLEVDGRKTVTLRAPGKLRQLNTDTGLYVGGMPDVGYFTHQRYFSGIVGCISEIVLAGEMKLNFD 1346
            .::|||.:.|:.|:||....:|....:|:||.|||...|..|:.|||.||:..:||.........
Human  4489 SIQVDGEELVSGRSPGPNVAVNAKGSVYIGGAPDVATLTGGRFSSGITGCVKNLVLHSARPGAPP 4553

  Fly  1347 PNTLGTEHNVETG 1359
            |..|..:|..:.|
Human  4554 PQPLDLQHRAQAG 4566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP2353NP_611082.2 FXa_inhibition 53..82 CDD:464251
LamG 404..555 CDD:238058 49/163 (30%)
EGF 583..612 CDD:394967 13/29 (45%)
LamG 625..774 CDD:238058 46/150 (31%)
LamG 1205..1340 CDD:214598 53/135 (39%)
HSPG2XP_011539620.1 Ig strand G 3834..3837 CDD:409353 1/57 (2%)
LamG 3848..4008 CDD:238058 48/160 (30%)
EGF_CA <4035..4064 CDD:238011 13/28 (46%)
EGF_CA <4076..4105 CDD:238011 1/28 (4%)
LamG 4117..4266 CDD:238058 46/148 (31%)
EGF 4291..4321 CDD:394967 11/30 (37%)
EGF_CA 4328..4359 CDD:238011 12/211 (6%)
LamG 4386..4545 CDD:238058 60/224 (27%)
SEA 80..193 CDD:214554
LDLa 216..251 CDD:238060
LDLa 302..336 CDD:238060
LDLa 342..376 CDD:238060
LDLa 385..420 CDD:238060
Ig_Perlecan_like 438..515 CDD:143220
Ig strand B 441..447 CDD:143220
Ig strand C 454..459 CDD:143220
Ig strand E 479..483 CDD:143220
Ig strand F 492..498 CDD:143220
Ig strand G 507..513 CDD:143220
LamB 608..734 CDD:214597
EGF_Lam 782..824 CDD:238012
EGF_Lam 831..888 CDD:238012
Laminin_EGF 897..939 CDD:395007
LamB 1003..1130 CDD:214597
EGF_Lam 1176..1225 CDD:238012
EGF_Lam 1227..1282 CDD:238012
Laminin_EGF 1293..1340 CDD:395007
LamB 1574..1699 CDD:214597
EGF_Lam 1746..1794 CDD:238012
Laminin_EGF 1796..1851 CDD:395007
IG_like 1866..1946 CDD:214653
Ig strand B 1877..1881 CDD:409353
Ig strand C 1890..1895 CDD:409353
Ig strand E 1912..1916 CDD:409353
Ig strand F 1926..1931 CDD:409353
Ig strand G 1939..1942 CDD:409353
IgI_Perlecan_like 1954..2039 CDD:409412
Ig strand A 1954..1958 CDD:409412
Ig strand A' 1963..1966 CDD:409412
Ig strand B 1970..1980 CDD:409412
Ig strand C 1986..1990 CDD:409412
Ig strand C' 1993..1995 CDD:409412
Ig strand D 2000..2005 CDD:409412
Ig strand E 2006..2012 CDD:409412
Ig strand F 2019..2027 CDD:409412
Ig strand G 2030..2039 CDD:409412
Ig 2049..2133 CDD:472250
Ig strand B 2066..2070 CDD:409353
Ig strand C 2079..2082 CDD:409353
Ig strand E 2099..2103 CDD:409353
Ig strand F 2113..2118 CDD:409353
Ig strand G 2126..2129 CDD:409353
I-set 2139..2225 CDD:400151
Ig strand B 2156..2160 CDD:409353
Ig strand C 2169..2173 CDD:409353
Ig strand E 2191..2195 CDD:409353
Ig strand F 2205..2210 CDD:409353
IG_like 2240..2317 CDD:214653
Ig strand B 2251..2255 CDD:409353
Ig strand C 2264..2268 CDD:409353
Ig strand E 2284..2287 CDD:409353
Ig strand F 2297..2302 CDD:409353
Ig strand G 2310..2313 CDD:409353
IG_like 2341..2418 CDD:214653
Ig strand B 2352..2356 CDD:409353
Ig strand C 2365..2369 CDD:409353
Ig strand E 2384..2388 CDD:409353
Ig strand F 2398..2403 CDD:409353
Ig strand G 2411..2414 CDD:409353
IG_like 2434..2508 CDD:214653
Ig strand B 2445..2449 CDD:409353
Ig strand C 2458..2462 CDD:409353
Ig strand E 2478..2481 CDD:409353
Ig strand F 2491..2496 CDD:409353
IG_like 2530..2607 CDD:214653
Ig strand C 2554..2558 CDD:409353
Ig strand E 2573..2577 CDD:409353
Ig strand F 2587..2592 CDD:409353
Ig 2620..2703 CDD:472250
Ig strand C 2650..2654 CDD:409353
Ig strand E 2669..2673 CDD:409353
Ig strand F 2683..2688 CDD:409353
IG_like 2731..2800 CDD:214653
Ig strand C 2747..2751 CDD:409353
Ig strand E 2766..2770 CDD:409353
Ig strand F 2780..2785 CDD:409353
IG_like 2819..2896 CDD:214653
Ig strand C 2843..2847 CDD:409353
Ig strand E 2862..2866 CDD:409353
Ig strand F 2876..2881 CDD:409353
Ig strand G 2890..2893 CDD:409353
IG_like 2916..2993 CDD:214653
Ig strand C 2940..2944 CDD:409353
Ig strand E 2959..2963 CDD:409353
Ig strand F 2973..2978 CDD:409353
IG_like 3016..3093 CDD:214653
Ig strand B 3027..3031 CDD:409353
Ig strand C 3040..3044 CDD:409353
Ig strand E 3059..3063 CDD:409353
Ig strand F 3073..3078 CDD:409353
Ig strand G 3086..3089 CDD:409353
IG_like 3115..3192 CDD:214653
Ig strand B 3125..3129 CDD:409353
Ig strand C 3138..3142 CDD:409353
Ig strand E 3158..3161 CDD:409353
Ig strand F 3171..3176 CDD:409353
Ig strand G 3184..3188 CDD:409353
Ig 3205..3291 CDD:472250
Ig strand B 3222..3226 CDD:409353
Ig strand C 3235..3240 CDD:409353
Ig strand E 3257..3261 CDD:409353
Ig strand F 3271..3276 CDD:409353
Ig strand G 3284..3287 CDD:409353
IG_like 3303..3385 CDD:214653
Ig strand B 3313..3317 CDD:409353
Ig strand C 3326..3330 CDD:409353
Ig strand E 3351..3355 CDD:409353
Ig strand F 3365..3370 CDD:409353
Ig 3404..3478 CDD:472250
Ig strand B 3412..3416 CDD:409353
Ig strand C 3425..3429 CDD:409353
Ig strand E 3444..3448 CDD:409353
Ig strand F 3458..3463 CDD:409353
Ig strand G 3471..3474 CDD:409353
I-set 3482..3565 CDD:400151 11/50 (22%)
Ig strand B 3499..3503 CDD:409353
Ig strand C 3512..3516 CDD:409353
Ig strand E 3531..3535 CDD:409353 1/3 (33%)
Ig strand F 3545..3550 CDD:409353 0/4 (0%)
Ig 3588..3666 CDD:472250 13/78 (17%)
Ig strand B 3600..3604 CDD:409353 0/3 (0%)
Ig strand C 3613..3617 CDD:409353 0/3 (0%)
Ig strand E 3632..3636 CDD:409353 0/3 (0%)
Ig strand F 3646..3651 CDD:409353 0/4 (0%)
Ig strand G 3659..3662 CDD:409353 1/2 (50%)
Ig 3676..3755 CDD:472250 12/78 (15%)
Ig strand B 3689..3693 CDD:409353 1/3 (33%)
Ig strand C 3702..3706 CDD:409353 1/3 (33%)
Ig strand E 3721..3725 CDD:409353 0/3 (0%)
Ig strand F 3735..3740 CDD:409353 1/4 (25%)
I-set 3764..3841 CDD:400151 24/156 (15%)
Ig strand B 3775..3779 CDD:409353 0/3 (0%)
Ig strand C 3788..3792 CDD:409353 2/3 (67%)
Ig strand E 3807..3811 CDD:409353 2/3 (67%)
Ig strand F 3821..3826 CDD:409353 0/4 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.