DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP2353 and NetB

DIOPT Version :9

Sequence 1:NP_001286474.1 Gene:SP2353 / 36771 FlyBaseID:FBgn0034070 Length:1361 Species:Drosophila melanogaster
Sequence 2:NP_001162753.1 Gene:NetB / 32400 FlyBaseID:FBgn0015774 Length:793 Species:Drosophila melanogaster


Alignment Length:391 Identity:74/391 - (18%)
Similarity:107/391 - (27%) Gaps:121/391 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 NATSNSLDGRGKSDEDVLYQKGASFSAKLANDDGGKSMAKSTFALSAAQSASPAGNENGEDESGS 150
            ||.|:.:.|..:.|||                                        ::.:.|...
  Fly   262 NAFSDEMGGSREEDED----------------------------------------DDADLELDG 286

  Fly   151 EGDSYDYGELEDSNS-----ETQEQKQKSLNLQQQQQQQQKVNSNDYYISAES-INFNSESEGQE 209
            |.|.||| .|:|::|     :..|:.:|.|.|.......      ||....|| :....:.:|..
  Fly   287 EQDEYDY-NLQDNDSADAGYDEYEEPKKHLELDDDHLHL------DYASDGESVVKRQGKHKGSA 344

  Fly   210 QQDVADFKAASTMLPSSVPPT--------PSRSTTRATASTTTTTTTTRRSPT------------ 254
            .:.....|.|:|..|...|..        ||.:...|.||..|...:...:.:            
  Fly   345 YEKHYQSKLAATTPPQQPPKVTPPGKVTPPSTAAPSAAASAVTLPISQHYAVSDFAVGGRCKCNG 409

  Fly   255 RAPKQRVDVDYGEGDGSDDYSYSYKSDMSVYDDVNNNQLNLRRNSKSQTYQQTSNTNTAKNR--- 316
            .|.:....|..|.|....|.......|......:.|:.....:.|...|.......|||...   
  Fly   410 HASECVATVSSGSGTALSDQDDGQDEDTPSAPSLANHFGRSTQMSAKLTMTCACKHNTAGPECER 474

  Fly   317 -------RKYPNVT---SNKVQM-----HITRETNRLENISAAEPAVVGAAM-----TTDRSTPT 361
                   |.:...|   :|:.:|     |..|....||....:.....|...     ||.|....
  Fly   475 CKPFYFDRPWGRATDNDANECKMCQCNGHARRCRFNLELYKLSGRVSGGVCYNCQHDTTGRYCHY 539

  Fly   362 C-------------------NLDCGSDGICALEATAASSRCLCPFGKTGNGCQ------EDIRAH 401
            |                   ..||...|.........|.:|.|..|.||..|.      :..|:|
  Fly   540 CREGYYRDATKPPNHRKVCKRCDCHPVGSTGKTCNHLSGQCPCKEGVTGLTCNRCARGYQQTRSH 604

  Fly   402 V 402
            |
  Fly   605 V 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP2353NP_001286474.1 FXa_inhibition 53..82 CDD:291342
LamG 404..555 CDD:238058
EGF 583..612 CDD:278437
LamG 625..774 CDD:238058
LamG 1205..1340 CDD:214598
NetBNP_001162753.1 LamNT 37..261 CDD:214532
EGF_Lam <458..484 CDD:238012 5/25 (20%)
EGF_Lam 498..555 CDD:238012 9/56 (16%)
EGF_Lam 560..608 CDD:238012 13/46 (28%)
NTR_netrin-1_like 661..791 CDD:239634
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10574
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.