DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP2353 and VC5.2

DIOPT Version :9

Sequence 1:NP_001286474.1 Gene:SP2353 / 36771 FlyBaseID:FBgn0034070 Length:1361 Species:Drosophila melanogaster
Sequence 2:NP_504797.1 Gene:VC5.2 / 179097 WormBaseID:WBGene00020908 Length:588 Species:Caenorhabditis elegans


Alignment Length:169 Identity:42/169 - (24%)
Similarity:60/169 - (35%) Gaps:51/169 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   670 FIALYLNDGFVEFAFDL----GSGPALVRSEHSLSLGQWHTIKISRTARLAVLKVDKHQEVLTIS 730
            |||.:|.|...|...||    |:|     |.|       ||         |.:.:.||.|:  ..
 Worm   367 FIAHHLGDQVAEDIEDLRVAGGTG-----SSH-------HT---------AAMLLVKHNEI--AE 408

  Fly   731 SNGFWHLSLDQNLFVGGVNHVDRLPLDLKYKPFFVG----CIQRIDI----NGHSLGIVAEALGG 787
            :....|    |......|:...|:.||.....|..|    |.::..:    .|.:|||..|    
 Worm   409 AGALAH----QKRIEESVSICKRIYLDYDGSCFCNGRSTMCDEKTHVCQNCTGGTLGIQCE---- 465

  Fly   788 SNIGNCPHACVARPCGPLAECVPQMESYECRCSIHNERC 826
                .||........|   :|||.::. :|.|:.|:..|
 Worm   466 ----KCPEDLRLDKTG---KCVPGLDP-DCFCNSHSYEC 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP2353NP_001286474.1 FXa_inhibition 53..82 CDD:291342
LamG 404..555 CDD:238058
EGF 583..612 CDD:278437
LamG 625..774 CDD:238058 27/115 (23%)
LamG 1205..1340 CDD:214598
VC5.2NP_504797.1 NPA 188..301 CDD:293078
NPA 310..429 CDD:293078 22/88 (25%)
EGF_Lam 487..531 CDD:238012 4/10 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3509
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.