DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP2353 and atrn

DIOPT Version :10

Sequence 1:NP_611082.2 Gene:SP2353 / 36771 FlyBaseID:FBgn0034070 Length:1361 Species:Drosophila melanogaster
Sequence 2:XP_002936412.3 Gene:atrn / 100486843 XenbaseID:XB-GENE-953934 Length:1352 Species:Xenopus tropicalis


Alignment Length:44 Identity:11/44 - (25%)
Similarity:22/44 - (50%) Gaps:8/44 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSQIQSVHT------PSVSLSKYRDQHFKGSRHEQEKLLRVSS 38
            :||.:.|:.:      |:...:....|.::.::.|.||  |||:
 Frog   102 VSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEK--RVSA 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP2353NP_611082.2 FXa_inhibition 53..82 CDD:464251
LamG 404..555 CDD:238058
EGF 583..612 CDD:394967
LamG 625..774 CDD:238058
LamG 1205..1340 CDD:214598
atrnXP_002936412.3 CUB 63..176 CDD:238001 11/44 (25%)
DSL 203..249 CDD:473190
NanM 270..566 CDD:442289
KELCH repeat 271..315 CDD:276965
KELCH repeat 322..366 CDD:276965
KELCH repeat 377..420 CDD:276965
KELCH repeat 431..480 CDD:276965
KELCH repeat 484..543 CDD:276965
CLECT 718..845 CDD:470576
PSI 857..908 CDD:396154
EGF_Lam 985..1030 CDD:238012
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.