DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment casp and SAY1

DIOPT Version :9

Sequence 1:NP_611080.1 Gene:casp / 36769 FlyBaseID:FBgn0034068 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_567380.2 Gene:SAY1 / 826779 AraportID:AT4G11740 Length:564 Species:Arabidopsis thaliana


Alignment Length:538 Identity:119/538 - (22%)
Similarity:188/538 - (34%) Gaps:143/538 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 VDKDFTIFIQFESDP----PLTLSLPGRMTVQEVKMNVFDIKSIPVRHQEWTGWPNGCDNDTTLA 293
            :|.||...: |:|||    |..:|.|.            :::.||:..::.:| |:|..:|....
plant    91 LDSDFARRV-FDSDPLMPRPPFVSHPR------------EVRQIPIEVKDSSG-PSGRSSDAPTI 141

  Fly   294 QSGIGLSHRFAVRSTERSAPTNSNQHNAFDVVTVDSESSTDEFEDATDFNNAEYIFTDSPPAQPP 358
            :.....:|.....:|:             ..|.:|.||.                  |..|..|.
plant   142 EDVTETAHVQGPVTTQ-------------GTVIIDEESD------------------DDIPFAPM 175

  Fly   359 NRHLIPNDTDDEISGSTQFVENYKARYGEPCPEFFVGSLENAKQLACLRSAKERKLL---AIYLH 420
            .|     ...|..:||.  ..|....|.:...|....::|.:|:.|   ......||   .:::.
plant   176 GR-----SRQDRPAGSV--ANNNNQDYNDIEEEMIRAAIEASKKEA---EGSSNPLLEERPLHME 230

  Fly   421 HGKSILSNVFCDQLMKHESIIQTFKEKFVLYGWDMTYESNKDMFLSSLTAC------ISSNASLT 479
            ....|...|........|.::::...|          .|..::..|::||.      .:.|..|.
plant   231 DDDDIAIAVTMSLKSAEEEVLRSQGYK----------ASTSEIGASAVTAAQGPQDTQALNGRLA 285

  Fly   480 ARNI-------KLDKLPAIM--------------LVGKSRQLGSNCEVLSVIH------------ 511
            |.:.       .:|:.|.:.              ...:||. ||..|..:.|:            
plant   286 APSSPFDDDSDDVDEQPLVRHRPRRAASGSLAPPNADRSRS-GSPEEEHASINPAERGSGFPSEW 349

  Fly   512 GNIGLDDLLTRLIETCEMF--------------EEQLQVEIR-QEDERAARDQVKAEQDMAYQET 561
            |.|..::....::....||              ..|.:.:.| ......|:..::.:||..|..:
plant   350 GGISSEEHDEAVMLEAAMFGGIPETGYNHLPFLPPQPRAQPRPPSPSLTAQRLIREQQDDEYVAS 414

  Fly   562 LQADMAKDAAK-RQKEAAQLAE---RKRM--ESERAEEDARR---ESIRLVAQ-----QSLPQEP 612
            ||||..|:... |..||.||.|   ||..  |.::.||:|:|   |...|..|     .|||:||
plant   415 LQADRDKEMKSIRDAEARQLEEETARKAFLEEEKKKEEEAQRKLEEEQELERQLDAKEASLPKEP 479

  Fly   613 SEQETGTSKIRVRKPTGDFLERRFFINNNLQDLLNFV-TANGFLIEEYKLISSWPRRDLTAIESS 676
            ...|.....:.:|.|.|....|||..::.||.|.||: .|.......|:|:..:||......||.
plant   480 QADEENAITLLIRMPDGTRRGRRFLKSDKLQTLFNFIDIARVVKPNTYRLVRPYPRHAFGDGESE 544

  Fly   677 QTLESLKL-YPQETVILE 693
            .||..|.| ..||.:.||
plant   545 STLNDLGLTSKQEALFLE 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caspNP_611080.1 UBA_FAF1 12..44 CDD:270596
UBL 148..>182 CDD:176364
UAS_FAF1 392..530 CDD:239288 26/179 (15%)
Faf1_UBX 616..695 CDD:176366 27/80 (34%)
SAY1NP_567380.2 UBA_Ubx1_like 6..42 CDD:270536
UBX 483..563 CDD:279169 27/80 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 42 1.000 Domainoid score I4781
eggNOG 1 0.900 - - E1_KOG1363
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23322
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.