DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment casp and AT4G10790

DIOPT Version :9

Sequence 1:NP_611080.1 Gene:casp / 36769 FlyBaseID:FBgn0034068 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_192817.1 Gene:AT4G10790 / 826675 AraportID:AT4G10790 Length:480 Species:Arabidopsis thaliana


Alignment Length:344 Identity:89/344 - (25%)
Similarity:160/344 - (46%) Gaps:47/344 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 ISGSTQFVENYKARYGEPCP---EFFVGSLENAKQLACLRSAKERKLLAIYLHHGKSILSNVFCD 432
            :..:.:||..:...||....   :|.|....:|.|    ||....|||.:|||......:.|||.
plant   161 VGEAMEFVALFDRDYGSNNAFKIDFVVEGFMDALQ----RSRSSFKLLFVYLHSPDHPDTPVFCG 221

  Fly   433 QLMKHESIIQTFKEKFVLYGWDMTYESNKDMFLSSLTACISSNASLTARNIKLDKLP--AIMLVG 495
            ..:.:|:::....|.||.:|..:.                ||.....:.::|..:.|  |:::..
plant   222 GTLCNEAVVAFVNENFVSWGGSIR----------------SSEGFKMSNSLKASRFPFCAVVMPA 270

  Fly   496 KSRQLGSNCEVLSVIHGNIGLDDLLTRLIETCEMFEEQLQVEIRQEDERAARDQVKAEQDMAYQE 560
            .::::.    :|..:.|....:::|..|....|.....|.....:.:||....:::.|||.||:.
plant   271 ANQRIA----LLQQVEGPKSPEEMLAILQRIVEDSSPTLVTARVEAEERRTNLRLREEQDAAYRA 331

  Fly   561 TLQADMAKDAAKR------QKEAAQLAERKRMESERAEEDARRES-------IRLVAQQSLP--Q 610
            .|:||.|::..::      ::|||: ||||..|.|.|.|.|.||:       :|:..:::|.  :
plant   332 ALEADQAREQQRQEEKERLEREAAE-AERKLKEEEEARERAAREAEERQAARVRMRQEKALALGE 395

  Fly   611 EPSEQETGTSKIRVRKPTGDFLERRFFINNNLQDLLNFVTANGFL-IEEYKLISSWPRRDLTAIE 674
            || |:....:::.||.|.|:...|.|.....:|.|.::|.:.|.| .|||.||:::||......:
plant   396 EP-EKGPDVTQVLVRFPNGERKGRMFKSETKIQTLYDYVDSLGLLDTEEYSLITNFPRTVYGRDK 459

  Fly   675 SSQTLESLKLYPQETVILE 693
            .|.:|:...|:||.::.:|
plant   460 ESMSLKDAGLHPQASLFIE 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caspNP_611080.1 UBA_FAF1 12..44 CDD:270596
UBL 148..>182 CDD:176364
UAS_FAF1 392..530 CDD:239288 30/139 (22%)
Faf1_UBX 616..695 CDD:176366 24/79 (30%)
AT4G10790NP_192817.1 UBA_FAF 11..42 CDD:270538
UAS 173..295 CDD:214737 30/145 (21%)
tolA_full 237..>362 CDD:274303 32/145 (22%)
SPFH_like <317..360 CDD:302763 14/43 (33%)
UBX 398..478 CDD:279169 24/79 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 42 1.000 Domainoid score I4781
eggNOG 1 0.900 - - E1_KOG1363
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23322
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.