DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment casp and faf2

DIOPT Version :9

Sequence 1:NP_611080.1 Gene:casp / 36769 FlyBaseID:FBgn0034068 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_001039235.1 Gene:faf2 / 734096 XenbaseID:XB-GENE-948050 Length:445 Species:Xenopus tropicalis


Alignment Length:365 Identity:88/365 - (24%)
Similarity:153/365 - (41%) Gaps:71/365 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 QPPNRHLIPNDTDDEISGSTQFVENYKARYGEPCPEFFVGSLENAKQLACLRSAK-ERKLLAIYL 419
            :|..|..:.:...|.:|    |::.::.:||...|.|:.|:...|     |..|| |.:.|.:||
 Frog   122 RPDPRSRVTDPVGDVVS----FIQLFEEKYGRIHPVFYQGTYSQA-----LNDAKQELRFLLVYL 177

  Fly   420 HHGKSILSNVFCDQLMKHESIIQTFKEKFVLYGWDMTYESNKDMFLSSLTACISSN------ASL 478
            |......|:.||...:....:......:.:.:                  || |:|      .|.
 Frog   178 HGEDHQDSDDFCRNTLCIPEVTNFLNSRMLFW------------------AC-STNKPEGFRVSQ 223

  Fly   479 TARNIKLDKLPAIMLVGKSRQLGSNCEVLSVIHGNIGLDDLLTRLIETCEMFEEQLQVEIRQEDE 543
            ..|......|..|||  |.|::    .|:..:.|.|...||:.:|....|..:..|..|..:.:|
 Frog   224 ALRENTYPFLAMIML--KDRRM----TVVGRLEGLIQPQDLINQLTFIVEANQTYLVSERLEREE 282

  Fly   544 RAARDQVKAEQDMAYQETLQADMAKDAAKRQKEAAQLAERKRMESERA--------------EED 594
            |.....::.:||.||..:|:||..|:..|::|:     |:||.|.|.|              ||:
 Frog   283 RNQTQVLRQQQDEAYLASLRADQEKERKKKEKQ-----EQKRREEEEAQLKQMLEERKKRNLEEE 342

  Fly   595 ARRESIRLVAQQSLPQEPSEQETGTSKIRVRKPTGDFLERRFFINNNLQDLLNFVTANGFLIEEY 659
            ..|:|      :.||.||........||..:.|.|..:||||....:|..:.:|:.:.....|::
 Frog   343 KERKS------ECLPAEPVPDHPDNVKIIFKMPNGTRVERRFLFTQSLSVIHDFLFSLKETPEKF 401

  Fly   660 KLISSWPRRDLTAIESSQ-----TLESLKLYPQETVILEE 694
            ::::::|||.|..:.|.:     ||:...|...:.:.:::
 Frog   402 QIVTNFPRRVLPCLPSEEIPVPPTLQEAGLSQSQLLFVQD 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caspNP_611080.1 UBA_FAF1 12..44 CDD:270596
UBL 148..>182 CDD:176364
UAS_FAF1 392..530 CDD:239288 33/144 (23%)
Faf1_UBX 616..695 CDD:176366 19/84 (23%)
faf2NP_001039235.1 UBA_FAF2 15..52 CDD:270597
UAS_ETEA 154..269 CDD:239289 33/144 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..354 17/61 (28%)
UBX_UBXN3B 362..441 CDD:340537 19/78 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2328
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.