DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment casp and ubxn8

DIOPT Version :9

Sequence 1:NP_611080.1 Gene:casp / 36769 FlyBaseID:FBgn0034068 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_001019583.1 Gene:ubxn8 / 554116 ZFINID:ZDB-GENE-050522-266 Length:272 Species:Danio rerio


Alignment Length:271 Identity:64/271 - (23%)
Similarity:101/271 - (37%) Gaps:79/271 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   500 LGSNCEVLSVI----------HGNIGLDDLL-------------TRLIETCEMFE-------EQL 534
            :.:.|.||.|:          |..||::|.|             |.||......:       ::|
Zfish     1 MSNRCVVLCVLLSGVCFIPWKHSIIGVNDALKLAGRGFIFLGICTWLISIFPRLKFFFFPVTQEL 65

  Fly   535 QVEIRQEDERAARDQV-KAEQDMAYQETLQADMAKDAAKRQKEA--AQLAER-KRMESER----- 590
            ......|..|...:|| :.:||:  |....:|.|::..|.::.:  .|..|| .||..|.     
Zfish    66 TDSPTPESSRLKEEQVRRTQQDL--QNDKMSDYAENVLKPRQNSLLQQKTERYYRMTGETWKLSP 128

  Fly   591 -----AEED-----------------ARRESIRLVAQQS-------------LPQEPSEQETGTS 620
                 .:||                 .||:.::.|.|..             ||.|||....|..
Zfish   129 GLPVGGDEDKICHAVDVDESPNQGARRRRKPMQTVTQDPVQEEVPKQKRVIVLPDEPSVDTEGAV 193

  Fly   621 KIRVRKPTGDFLERRFFINNNLQDLLNFVTANGFLIEEYKLISSWPRRDL-TAIESSQTLESLKL 684
            ||.:|.|....:.|||....:.|.||.::...|:....|.|..|:||.:: ||.:.|  ||...:
Zfish   194 KIALRFPGRRAIHRRFLKTWSSQLLLEWMMKTGYPPALYTLYMSYPRTEVQTAADMS--LEEAGI 256

  Fly   685 YPQETVILEER 695
            :....:.:||:
Zfish   257 HTDTLLNVEEK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caspNP_611080.1 UBA_FAF1 12..44 CDD:270596
UBL 148..>182 CDD:176364
UAS_FAF1 392..530 CDD:239288 12/52 (23%)
Faf1_UBX 616..695 CDD:176366 23/79 (29%)
ubxn8NP_001019583.1 UBQ 190..266 CDD:294102 22/77 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.