DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment casp and Faf2

DIOPT Version :9

Sequence 1:NP_611080.1 Gene:casp / 36769 FlyBaseID:FBgn0034068 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_001286057.1 Gene:Faf2 / 35129 FlyBaseID:FBgn0025608 Length:464 Species:Drosophila melanogaster


Alignment Length:353 Identity:86/353 - (24%)
Similarity:163/353 - (46%) Gaps:59/353 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 DEISGSTQFVENYKARYGEPCPEFFVG----SLENAKQLACLRSAKERKLLAIYLHHGKSILSNV 429
            |.:....:|:..|..||.|. |.|:.|    :|.:|||        |.:.|.:|||...:...:|
  Fly   141 DPLGDVMKFIREYYERYPEH-PVFYQGTYAQALNDAKQ--------ELRFLIVYLHKDPAKNPDV 196

  Fly   430 --FCDQLMKHESIIQTFKEKFVLYGWDM-TYESNKDMFLSSLTACISSNASLTARNIKLDKLPAI 491
              ||...:...|:|.......:|:|.|: |.|..:.|  .|:|  :.|..::...:::.:::   
  Fly   197 ESFCRNTLSARSVIDYINTHTLLWGCDVATPEGYRVM--QSIT--VRSYPTMVMISLRANRM--- 254

  Fly   492 MLVGKSRQLGSNCEVLSVIHGNIGLDDLLTRLIETCEMFEEQLQVEIRQEDERAARDQVKAEQDM 556
            |:||:             ..|:...::||.||.......|..|........||.....::.:||.
  Fly   255 MIVGR-------------FEGDCTPEELLRRLQSVTNANEVWLSQARADRLERNFTQTLRRQQDE 306

  Fly   557 AYQETLQADMAKDAAKRQKE------AAQLAERKRMESERAEEDARRESIRLVAQQSLPQEPSEQ 615
            ||:::|.||..|: .:||:|      |.:..|:.|.:.|..:|:..|:.|.|..  .:|.||:..
  Fly   307 AYEQSLLADEEKE-RQRQRERDAVRQAEEAVEQARRDVELRKEEIARQKIELAT--LVPSEPAAD 368

  Fly   616 ETGTSKIRVRKPTGDFLERRFFINNNLQDLLNFVTANGFLIEEYKLISSWPRRDL---------- 670
            ..|...:..:.|:|..|||||...:::.|:.:::..:....:|:::.:::|:|.|          
  Fly   369 AVGAIAVVFKLPSGTRLERRFNQTDSVLDVYHYLFCHPDSPDEFEITTNFPKRVLFSKANLDAAG 433

  Fly   671 ---TAIES-SQTLESLKLYPQETVILEE 694
               ||.|: ::||:::.|..:|.:.:.:
  Fly   434 ETGTAKETLTKTLQAVGLKNREVLFVND 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caspNP_611080.1 UBA_FAF1 12..44 CDD:270596
UBL 148..>182 CDD:176364
UAS_FAF1 392..530 CDD:239288 33/144 (23%)
Faf1_UBX 616..695 CDD:176366 20/93 (22%)
Faf2NP_001286057.1 UBA_FAF2 12..49 CDD:270597
UAS_ETEA 163..280 CDD:239289 33/144 (23%)
ATP-synt_B <287..>373 CDD:304375 25/88 (28%)
UBQ 373..462 CDD:294102 19/89 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439340
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1363
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23322
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2328
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.