DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment casp and CG8892

DIOPT Version :9

Sequence 1:NP_611080.1 Gene:casp / 36769 FlyBaseID:FBgn0034068 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_001260064.1 Gene:CG8892 / 33719 FlyBaseID:FBgn0031664 Length:496 Species:Drosophila melanogaster


Alignment Length:366 Identity:62/366 - (16%)
Similarity:141/366 - (38%) Gaps:83/366 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 STQFVENYKARYGE----PCPEFFVGSLENAKQLACLRSAKERKLLAIYLH----HGKSILSNVF 430
            ||.......:|.|:    |....:.|||..|::.|    .|.::.|.:.:.    ..:::..:|:
  Fly   161 STTDTATSTSRLGDLFRPPTDILYSGSLTAAREFA----TKRQRWLLVNVQDENFQSQTLNRDVW 221

  Fly   431 CDQLMKHESIIQTFKEKFVLYGWDMTYESNKDMFLSSLTACISSNASLTARNIKLDKLPAIMLVG 495
            .|:.:|     :..:.:|..  |.:..::::.....:...|.:              ||.|.::.
  Fly   222 SDKELK-----KLIRRQFTF--WQVDNDTSEGRRFVAFYHCAT--------------LPYICVID 265

  Fly   496 --KSRQLGSNCEVLSVIHGNIGLDDLLTRLIETCEMFEEQLQVEIRQEDERAAR---DQVKAEQD 555
              ...::..:.|.        .|:::|..|.:..:...:.:|.:.....:|:|.   |....:.:
  Fly   266 PRTGEEVWRSAEP--------KLENILPDLRQFLKEHRDFIQEDAPGTSKRSATYIDDDEVPDPE 322

  Fly   556 MAYQETLQADMAKDAAKRQKEAAQLAERKRME----------------------------SERAE 592
            .:...|..   :|:..|::.:..:|.|.:::|                            ...:.
  Fly   323 ASCSSTAS---SKEMPKKRAKVLELTEEEQLELAIKNSINENGGGGGEGNQKNDSPDGASDNESL 384

  Fly   593 EDARRESIRLVAQQSLPQEPSEQETGTSKIRVR----KPTGDFLERRFFINNNLQDLLNFVTANG 653
            |:...|.::.||..|......|.:|..:.:::|    ..|.:.::.|:..:..||.|..:::...
  Fly   385 EEFDDEELKGVAAASFENHLGEAKTELTALKLRLLNAAGTDEMVQLRWPSDTKLQTLRLYISQTH 449

  Fly   654 FLIEE--YKLISSWPRRDLTAIESSQTLESLKLYPQETVIL 692
            ..|.:  ||||.::||:.|.|..:..:|:.|.|:|...:.|
  Fly   450 KHIPQDGYKLICAFPRKFLEAEHNDSSLKELGLHPSANLHL 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caspNP_611080.1 UBA_FAF1 12..44 CDD:270596
UBL 148..>182 CDD:176364
UAS_FAF1 392..530 CDD:239288 20/143 (14%)
Faf1_UBX 616..695 CDD:176366 21/83 (25%)
CG8892NP_001260064.1 UBA_4 9..46 CDD:291236
UAS 183..294 CDD:239256 20/143 (14%)
UBQ 412..488 CDD:294102 19/75 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23322
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.